KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03299Help
Entry
PXO_03299         CDS       T00763                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PXO_03299
Enzymes [BR:xop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PXO_03299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5101158..5102159)
Genome map
AA seq 333 aa AA seqDB search
MLLLAAMPLAQAQGTYGLKYAGVNLSGAEVNSSQQPGVLDIDYHYPAADEYTYFAGKYMN
TVRLPILWERLQPKPGGQLDPAQLALIREAVANAKAAKMYLIVDVHNYAKYYGHTIGSTN
VPIRTFNDLWRRLAIAFKSDKAVIFGLMNEPHDIEPQAWATAAQASIDTIRKTGATNLIL
VPGALWTGAHSWYSTVAGQSNAVAMASIHDPLNRYAIEAHQYLDADSSGTSGACVSATVG
VERLRSFTQWLRLNGKRGFLGEFGTGKTVTCNLALKGMLGYMESNSDVWMGWAYWAAGTW
WNRGYPFNVQPDAQGRDKPQMSILSQQAHRITD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgttattgctggccgccatgccgctcgcgcaggcgcaaggcacttatggcctgaaatat
gcaggcgtcaatctatccggcgccgaggtcaattcctcgcaacagcccggcgtactcgac
atcgactatcactatccggcggccgacgaatacacctatttcgccggcaagtacatgaac
accgtgcgcttgccgatcctatgggaacggctgcagccaaagccgggcggccagctggac
ccggcgcagctggcgttgatccgggaggcggtcgccaacgccaaggcggccaaaatgtac
ttaatcgtggatgtgcacaactacgccaagtattacggccacaccatcggcagcacgaac
gtgccgatcaggaccttcaacgatttgtggcgacggctggcgatcgccttcaagagcgac
aaggccgtgatattcgggctgatgaatgagcctcacgacatagaaccgcaagcgtgggcg
acggccgcgcaggcgtcgatcgacaccattcgtaaaaccggcgccaccaatctgattctg
gtgccgggtgcgttatggacaggcgcgcacagctggtactccacggtagctgggcaatcc
aatgcagtggcgatggcatccattcacgatccgctcaatcgttatgcgatcgaggcacat
caatatttggatgccgattccagcggtaccagcggcgcttgcgtcagcgccacggtcggg
gtcgagcgcttgcgcagcttcacccaatggctgcgtctaaacggaaaacgcgggtttctc
ggcgaatttggtaccggcaagacggtcacctgcaatctcgcgctcaagggcatgctgggc
tacatggaatctaacagtgacgtgtggatgggatgggcctactgggcagcaggcacctgg
tggaacagggggtatccgttcaatgtgcaaccggatgcgcaggggcgcgacaagccgcag
atgtccatattgagccagcaggcgcaccggattaccgattaa

DBGET integrated database retrieval system