KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03307Help
Entry
PXO_03307         CDS       T00763                                 

Definition
transglycosylase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xop00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5094790..5096952)
Genome map
AA seq 720 aa AA seqDB search
MTLPRRALPLVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVL
PLLDAQPEFTTPIWDYLASLVDNQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFG
QTQFMPSTYTRIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQTAGLLGTDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRGGPGLIATWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQIRLGLQPADGRPGQRILTALRAAPPLAGVAAVRATAFKLPTAY
PAFAQSAIVHKASPMSDTTGLTTGDFHGFPSLLIETPFSTAAISLFGGQLVSFVPKGGQD
VMWLSPLAKQPPTPIRGGAPVCWPYFGRQGQIGDVPAHGFVRTVAWRLTESRREDDGTVV
LTLTPPRLDDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKISVQ
GLDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRIVIA
TEGSRSLVAWNPGEEAGKKMADVGDGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccccggcgcgcattgccgttggtgctgggactgctgccactggccgcctgc
gccgatcccgccttcgaccgctgcctggctggcctgcagacccaggccgctgccaagggc
gtggaccctgcaggctttcagcgtttcaccgccgggctggtgcctgatcccagcgtgttg
ccgctgctggatgcacagcccgaattcaccacgccgatctgggattacctggccagcttg
gtcgataaccagcgcgtgaccgatggccaggccatgctggtcacccaccgcgcgctgttg
actcgcctgtccgaacaaaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgactacggccgcgtcaccggcaagcgcccgctgctggtgtcgctggccacgctg
tcgtgtgcaggccgccgccagccgttcttccgtgacgaattcctcgccttgctcagcctg
ctgcaacgaggcgatctggctgcggatgggctgaccggctcctgggccggcgcattcggg
cagacccagttcatgccctcgacctacacccgcatcgcggtggatggcgacggcgacggc
cgccgcgatctggtcgccagcattcccgacgcactggcctcgaccgccaactatctggtc
aaggccggctgggaacgcgcccgcccgtggggcatggaagtcacgctgccgcgcgggttc
gatgccagcaaggccggccgcacccgccgccaaccgctgcaggcctggcaaaccgccggc
ctgctcggcaccgacggcaaaccgctggcaccgatcgggttgccggcggagacccccgcc
gccttgctgctgccggccggcgccaccggcccggcgttcctggtgttccgcaactacgac
gccatttatgcttacaacgccgccgaaagttacgcgctgtccatcgccctgctcgccgac
cgcctgcgcggcggccccggcctgattgccacctggcccaccgacgacccgggcctgggg
cggcccgaacggcgcgaactgcagcagttgctgctcgcccgcggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgtgccatccaggtcgagcagatccgcctg
ggcctgcaaccggccgacggccgtcccggccaacgcatcctcaccgccctgcgcgccgcg
ccgccgctcgccggcgttgcggccgttcgcgccaccgccttcaagctgccgaccgcatac
ccggccttcgcccaatccgccatcgtccataaggcatcccccatgtccgacaccaccggc
ctgaccacaggcgatttccacggctttccatcgctgctgatcgaaacgccgttctccacc
gcggccatcagcctgttcggcgggcaactcgtgtcgttcgtgcccaagggcggccaagac
gtgatgtggctgtcgccgctcgccaagcagccgcccaccccgatccgcggtggtgcgccg
gtgtgctggccgtatttcggtcgccagggccagatcggcgatgtccccgcccacggcttc
gtccgcaccgtggcctggcgactcaccgaaagccgccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgcttggacgacctggcgttgcgcctgcgcatgacgctgcgc
atcggccgcacgcttgagcaacgcctgatcactgaaaacaccagcgccgccccggtgcgt
ttcacccaggcgctgcacaactatttccgcgtcggcgacgcgctgaagatcagcgtgcag
ggcctggatggcctggactacctcgataaatacgagaactacgctaccgcacaccgtcag
caaggcgactggagcctgcgcgacccacgcgatcccggccgcagcgaccgtatctacacc
aatgccggtggccgctacacgctcaccgacccggtgctcggccgccgcatcgtcatcgcc
accgaaggcagccgctcgctggtggcttggaatccgggcgaagaggccggcaagaagatg
gccgacgtgggcgacggctggcgcgactacgtctgcctggaagcggccaacgccggcccg
gatgtgatcgaactcgcccccggcgccagccacaccctgacccagaccatcagtgtcgag
taa

DBGET integrated database retrieval system