KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03354Help
Entry
PXO_03354         CDS       T00763                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop00020  Citrate cycle (TCA cycle)
xop00620  Pyruvate metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
Module
xop_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_03354
   00020 Citrate cycle (TCA cycle)
    PXO_03354
   00620 Pyruvate metabolism
    PXO_03354
Enzymes [BR:xop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PXO_03354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: ACD56801
UniProt: A0A0K0GFM8
Position
complement(130100..130432)
Genome map
AA seq 110 aa AA seqDB search
MRANQVRESVNRLRQQVEKRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIMAAG
RARYQITPVMGGVETHKVMPLSLTFDHCAATGGEAARFLRALLDDLALAN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgctaatcaggtccgcgaaagcgtcaaccggctacgtcagcaggtggaaaagcgc
agcatcgccgcgtccgaattgagcgggtacaccatctcgctgtccaacttcggcatgttc
gccggccgctacgccacgccggtggtggtgccgccgtgcgtggcgatcatggccgccggc
cgtgcgcgctaccagatcaccccggtgatgggcggcgtggaaacccacaaggtgatgccg
ctgtcgttgaccttcgatcactgcgccgccaccggcggtgaagcagcgcgcttcctgcgc
gcattgctagacgatctggcgttggccaactga

DBGET integrated database retrieval system