KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03373Help
Entry
PXO_03373         CDS       T00763                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PXO_03373 (malQ)
Enzymes [BR:xop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PXO_03373 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104879..106771
Genome map
AA seq 630 aa AA seqDB search
MMVDWVDASDQPRHVSEQSVHAVLTALELPAATAAQRADSLRRCQAQAAEPAPLLTVQVG
ELLPLRVAANTIGRWTDDSGASEDARTDARGQLRAPPRFGYWTLQIGAITQHVAVAPRRC
FSVADACGQASPRAWGMALQVYSARSLDDGGIGDAAGTVEWLRHATLAGADALALSPVHA
SRPVTGAYSPYSPSDRRFLDPLHAAPVRILGELALDAINAVPGLRERFDRLHDGALIDWQ
ASAHAKWELLRQLYTRVAPDHADLVAFGNADGAALQGFARFAAQDFGDNDPQLHVFTQWL
AARSWSDAQRQAHERGMKIGLIADLAVGFDPNGAEAAAAADTVLRGLVLGAPPDAFNADG
QHWGIGAYSPTALRRSGYAPYIALLRAVLRDRGGIRIDHILGLMRLWVVPDGASSNEGAY
LAYPLHDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSRRGVMGIDVLMFTRDDDGAF
VSPALWRPDAIATTTTHDLPTLTGWREGRDIAWRRKLALIQPAQASDDAKARIKDVARLE
AAVEHAGLSSAHDPLLGALRFTAASVSPLALLPVEDALALDEQPNLPGTVEVHPNWRRRL
PDPLPHARLSSALQGFAEARRVAAVSEPHP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggattgggtggatgccagcgaccagccgcggcatgtgtccgagcaatcggtg
catgccgtgctcaccgcgttggaattgcccgccgccaccgcggcgcaacgcgccgacagc
ctgcgccgctgccaggcacaggccgccgagccggcgccgctgctgacggtgcaggtgggt
gagttgctgccattgcgcgtggcagccaatacaatcggtcgctggaccgacgacagcggt
gccagcgaagacgcccgcacagatgcacgagggcaactgcgcgcgccgccgcgtttcggt
tactggacgctgcagatcggcgcgatcacccagcacgtggccgtggcaccgcgccgctgt
ttcagcgtggccgatgcctgtggccaagcatcgccgcgtgcctggggcatggcgctgcag
gtgtattcggcacgcagcctggatgacggcggtatcggcgatgctgccggcacggtggaa
tggctgcggcacgcgaccttggccggcgccgacgccctggcattgagtccggtgcacgcc
tcgcgcccggtgacgggcgcctacagcccgtattcgccgagcgatcggcgctttctcgat
ccgttgcatgccgcaccggtgcgcatcctgggtgaactggcgctggatgcaatcaacgcg
gtgcccggtctgcgcgaacgtttcgatcgcctgcacgatggcgcattgatcgattggcag
gcctcggcgcacgccaagtgggaattgctgcgccagttgtacacgcgtgttgcgcccgat
catgccgacctggtcgcattcggcaacgcagacggcgcggcgctgcagggctttgcacgc
tttgctgcgcaggatttcggcgacaacgatccgcagttgcatgtgttcacccaatggctg
gcagcgcgcagctggtccgatgcgcaacgccaggcgcatgagcgcggcatgaagatcggg
ttgatcgccgatctggcggtcggcttcgaccccaatggcgccgaagccgcagcagcagca
gacaccgtgttgcgcgggctggtgctgggcgcgccaccggatgcgttcaatgctgatggt
cagcattggggcattggcgcgtactcgcccaccgcattgcgacgcagcggctacgcgccg
tacatcgcactgctgcgcgcggtgttgcgcgaccgtggcggtatccggatcgatcacatc
ctgggcctgatgcggctgtgggtggtgcccgatggcgccagttccaacgaaggcgcgtat
ctggcgtacccgttgcacgatctgctcaatctgctcgcgctggaatcgtggcggcatcgc
gcaattgtcatcggcgaggatctgggcgtggtgccgccgggcatccgcgaagaactgtcg
cggcgtggggtcatgggcatcgatgtgttgatgttcacccgcgacgacgacggcgcgttc
gtctcgccggcgctatggcggccggatgcgatcgccaccaccaccacccacgacctgccc
acgctcactggctggcgcgaaggccgcgatatcgcatggcggcgcaagctggcattgatc
cagcctgcgcaggccagcgatgacgccaaagcgcgcatcaaggacgtggcacggctggaa
gccgctgtcgaacacgccggcctgagcagtgcgcatgacccgctgctgggcgcattgcgt
ttcaccgccgccagcgtctcgccactggctttgttgccggtggaggatgcgctggcgctg
gacgaacaacccaatctgccgggcaccgtcgaagtgcatcccaactggcgtcgacgcctg
cccgatcccttgccgcatgcgcgcctgagttcggcgctgcagggctttgccgaggcgcgt
cgcgtcgcggccgtttcggaaccgcatccatga

DBGET integrated database retrieval system