KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03375Help
Entry
PXO_03375         CDS       T00763                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PXO_03375 (glgB)
Enzymes [BR:xop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PXO_03375 (glgB)
Exosome [BR:xop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PXO_03375 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
100879..103065
Genome map
AA seq 728 aa AA seqDB search
MTTEGISEMSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLL
ARMQASAIDGVFEGILSIEGPYRLRIVWPDMVQKIEDPYAFAVTLDESLLLQIAAGDGQA
LRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPR
VEAGPRYKYAVTAADGRVLLKADPVARQTELPPATASVVPGTATFAWTDAAWMAKRDPSA
VPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWG
YQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEH
ADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIDHYHLDGLRVDAVASMLYRDYGRAE
GEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGLGFTH
KWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQM
PGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQL
LVGDLNATLRRTPALYRGTHRAEGFDWSVADDARNSVLAFIRHDPDGGGVPLLAVSNLTA
QPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTLPPLA
TIYLQAEK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggaagggatctcggagatgtcgcagaccctgcaagcgctggccgatggattg
ccggtcgacgcctttgcggtccttgggccgcacccgctcgccgatgggcgccgccaagtg
cgtgtgctggcgccgggggccgaggcgatggggttgatcgactcgcgcggcaagttgctg
gcacgcatgcaggctagcgcgattgacggcgtctttgaaggcatcctgtcgatcgaaggg
ccgtaccggctgcgcatcgtgtggccggacatggtgcagaagatcgaagacccgtacgcg
ttcgcggtcacactggacgaatcgctgttgctgcagatcgccgctggcgatggtcaggcg
ctgcgccgcgcgctgggcgcgcagcatgtgcaatgtggcgaagtgcccggcgtgcgcttt
gcagtgtgggcaccgcatgcgcaacgcgtggccgtggttggtgacttcaatggctgggac
gtgcggcggcacccgatgcgccagcgtatcggcggcttctgggaactgtttctgccgcgc
gtggaagctggcccgcgctacaagtacgccgtcactgcagccgatggccgcgtgctgctc
aaggccgacccggtggcgcggcaaaccgaattaccgccggccaccgcctcggtggtgccc
ggcacggccacctttgcgtggaccgacgcggcctggatggccaagcgcgatcccagcgcc
gtgccggcgccgctgtcgatctacgaagtgcatgccgcgtcctggcgccgcgacggacat
aaccagccgctggactggccaaccctggccgagcaactgattccctacgtgcagcagctc
cgcttcacccatatcgaattgctgccgatcaccgagcacccgttcggcggttcctggggc
taccagccgctgggcctgtatgcgcccaccgcccgccacggcagcccggacgggtttgcg
cagttcgtcgacgcctgccaccgcgctggcatcggcgtgatcctggactgggtcagcgcg
cacttccccgatgacgcgcatgggctggcgcagttcgacggcgccgcgctgtatgagcac
gccgaccctcgggaaggcatgcatcgcgactggaacaccctgatctacaactacggccgg
ccggaagtgaccgcctacctgctggggagcgcgctggagtggatcgaccattaccatctc
gacggcctgcgcgtggatgcggtggcctcgatgctgtaccgcgactacggccgcgccgaa
ggcgagtgggtgcccaacgcgcatggcggccgcgagaatctagaggcagtggcgttcctg
cgtcagctcaaccgcgagatcgccgcacacttccccggcgtgctcaccatcgccgaagaa
tccaccgcctggccgggcgtgaccgcggcgatcagcgatggcggcctgggcttcacgcac
aaatggaacatgggctggatgcacgacacgctgagctatatgcagcgcgatccagccgaa
cgtgcgcatcaccatagccagctcaccttcgggctggtgtacgcattcgacgagcggttc
gtcttacccatctcgcacgatgaagtggtgcacggcaccggtggcttgctcgggcagatg
ccgggcgacgactggcgccgcttcgccaacctgcgcgcgtatctggcgctgatgtgggcg
cacccgggcgacaaactgctgttcatgggcgccgaattcggtcaatgggccgattggaat
catgaccagtcgctggattggcatctgcttgaaggcgcgcgccaccgcggcgtgcagctg
ctggtgggcgacctcaacgccacgttgcgtcgcactcccgcgttgtatcgcggtacccat
cgcgccgaaggtttcgactggagcgtggccgacgacgcgcgcaacagcgtcttggccttc
atccgccacgatcctgacggcggcggcgtgccgctgctggcagtgagcaacctcaccgcg
caaccgctgcacgactatggcgtgggcgtgccgcgcgccggcgcctggcgcgaaatcctc
aacaccgacagtgcccattacggtggcagcaacctcggcaacagcggtcgtcttgcgact
gagccgatgggcatgcatgggcatgcgcaacgcctgcgcctgaccctgccgccgctggcc
acgatctatctgcaagcggagaaatag

DBGET integrated database retrieval system