KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03535Help
Entry
PXO_03535         CDS       T00763                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00790  Folate biosynthesis
xop01100  Metabolic pathways
Module
xop_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PXO_03535 (folE)
Enzymes [BR:xop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PXO_03535 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF XendoU
Motif
Other DBs
NCBI-ProteinID: ACD61614
UniProt: A0A0K0GRH3
Position
complement(5196329..5196901)
Genome map
AA seq 190 aa AA seqDB search
MTQTQAEDAVRILLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEPREYLERTFEEVA
GYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRCKVVGISKLARVVESYARRFQVQEK
MTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEF
LQFIEVGGKR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaaacccaggccgaagacgccgtgcgcatcttgttgcgctgggcgggcgaagat
ccgacgcgtgaaggcctgctggacaccccacgccgggtggccgaagcctatggcgactgg
ttcagcggctaccgcatagaaccgcgcgaatacctggaacgcaccttcgaagaagtggcc
ggctatgacgaactgatcgtgctgcgcgacatctcgtatgaaagccattgcgagcaccac
atggcgccgatcatcggcaaggtgcacgtgggctatctgccccgctgcaaggtggtcggc
atcagcaagctggcccgcgtggtggaaagctacgcgcgccgcttccaggtgcaggaaaag
atgaccgcacagatcgcccagtgcatccaggacgtgctgcaaccgctcggcgtgggcgtg
gtggtggaaggcgcgcacgaatgcatgaccacccgcggcatccacaagcgcggcgtcagc
atggtgacctccaagatgctgggcagcttccgcgaagacgcgcgcacccgcgccgaattc
ctgcagttcatcgaagtgggtggcaagcgttga

DBGET integrated database retrieval system