KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03568Help
Entry
PXO_03568         CDS       T00763                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase, type I
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00220  Arginine biosynthesis
xop00250  Alanine, aspartate and glutamate metabolism
xop00630  Glyoxylate and dicarboxylate metabolism
xop00910  Nitrogen metabolism
xop01100  Metabolic pathways
xop01120  Microbial metabolism in diverse environments
xop01230  Biosynthesis of amino acids
xop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PXO_03568 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    PXO_03568 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PXO_03568 (glnA)
   00220 Arginine biosynthesis
    PXO_03568 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PXO_03568 (glnA)
Enzymes [BR:xop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     PXO_03568 (glnA)
Exosome [BR:xop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PXO_03568 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-ProteinID: ACD56956
UniProt: A0A0K0GG26
Position
305627..307030
Genome map
AA seq 467 aa AA seqDB search
MENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPANIIEPALFEEGKMFDGSSIAGWKGIN
ESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQSYERDPRGIAKRAEAYLKSSGTA
DQAFFGPEPEFFIFDSVRFANDMGHTFFQVGSEEAAWNTGEKYDGGNSGYRPGVKGGYFP
VPPTDTLHDLRAEMIKTLEQVGIETEVHHHEVATAGQCEIGTKFSSLVQKADELLTMKYI
IKNVAYRNGKTATFMPKPIVGDNGSGMHVHQSLAKGGVNLFTGDGYGGLSQLALWYIGGI
FKHARAINAFANSGTNSYKRLVPGFEAPVMLAYSARNRSASCRIPWVTNPKARRIEMRFP
DPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYDLPPEEEKLIPQVCSSLDQALDAL
DKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAATHPLEYQLYYGN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatgttgaaaagctgatcaaggacaacaaggtcgagttcgtcgacctgcgcttc
gtcgatatgcgtggtgtacagcagcacatcacctttccggccaatatcatcgagccggcg
ctgtttgaagaaggcaagatgttcgacggcagttcgatcgcgggttggaagggcatcaac
gagtcggacatggtgctgctgccggacgcaggcaccgcgtatctggatccgttcttcgcc
gatccgaccatcgtgctgacctgcgacatccttgacccggccaccatgcagagctatgag
cgcgatccgcgcggcatcgccaagcgcgccgaggcctatctgaagtcgtccggcaccgcc
gaccaggcgttcttcggcccggagccggaattcttcatcttcgattcggtgcgctttgcc
aacgacatgggccacaccttcttccaggtgggttcggaagaagcggcctggaataccggt
gaaaagtacgacggcggcaatagcggctaccgtccgggcgtgaagggcggctacttcccg
gttccgccgaccgacaccctgcacgacctgcgcgcggaaatgatcaagacgctggaacag
gtcggcatcgaaaccgaagtgcaccaccacgaagtggccaccgccggtcagtgcgaaatc
ggcaccaagttcagctcgctggtgcagaaggccgacgaactgctgacgatgaagtacatc
atcaagaacgtcgcctaccgcaacggcaagaccgccaccttcatgcccaagcccatcgtg
ggcgacaacggctcgggcatgcacgtgcaccagtcgctggccaagggcggcgtcaacctg
ttcaccggcgacggctacggcggtttgtcgcagctggcgctgtggtacatcggcggcatc
tttaagcacgcccgcgcgatcaacgccttcgccaactccggcaccaacagctacaagcgt
ctggttccgggcttcgaggcaccagtgatgctggcctattcggcgcgtaaccgctcggcg
tcgtgccgtattccgtgggtcaccaacccgaaggcgcgccgcatcgaaatgcgcttcccc
gatccgttgcagtccggctacctgaccttcaccgcgctgatgatggccggcttggacggc
atcaagaaccagatcgaccctggcgcaccgagcgacaaggacctgtacgacctgccgccg
gaagaagagaagctgattccgcaggtctgctccagcctggatcaggccctggacgcgctg
gacaaggaccgcgagttcctcaaggccggcggcgtgatgagcgacgacttcatcgacggc
tatatcgcgctgaagatgcaggaagtcaccaagttccgtgctgcgacccacccgttggag
taccagctgtactacggcaactga

DBGET integrated database retrieval system