KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03570Help
Entry
PXO_03570         CDS       T00763                                 

Definition
(GenBank) protein of unknown function (306) family
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: META DUF4377 Hydantoinase_B
Motif
Other DBs
NCBI-ProteinID: ACD56953
UniProt: A0A0K0GFS7
Position
complement(303659..304456)
Genome map
AA seq 265 aa AA seqDB search
MFFAPALLAAGVTACGSGASPELPGANHAAVRMPVMASPDTDALPLRTALRAQHWQLQQA
SDAHGTALRSLFVDGLPAVQLDFNDQRIQVSQTCNALGAIYSVAQAQVQIGRVVSSRRMC
ADARRMAQERAASDLLSGRFAVVMDTAAAAPRLTLTRSDGTRLIFGGTPTADTRYGGPGQ
TLLIEVAADTVTCASDPTRRCLQVREQTQADQSATHDWQPLEGTIDGFEHEDGIRNLLRV
TRYPAGTDRNADQVYVLDQMLEASS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgttcttcgcccctgcactgctggcggcgggcgtgacggcctgcggatcgggcgcgtcg
ccggagctgcccggcgccaaccacgctgctgtccggatgcctgtcatggcgagccctgac
acggatgccctgccgttgcgcaccgccttgcgcgcacagcactggcaattgcagcaggcc
agcgatgcgcacggcaccgccttgcgcagcctgttcgtcgacggcctgccagccgtgcaa
ctggacttcaacgatcagcgcatccaggtcagccagacctgcaacgcgttgggcgccatc
tacagcgtggcccaggcgcaggtgcagatcggccgggtggtctcgagcaggcggatgtgc
gccgacgcacgccggatggcgcaggaacgcgctgccagcgacctgctgtccggccgcttc
gccgtggtcatggacaccgccgcggccgcgccccggctgaccctgacccgcagcgatggc
acccggctgatcttcggcggcacccccacggcagacacccgctacggcgggccggggcag
acgttgttgatcgaagtggccgcagacaccgtgacctgcgcgtccgacccgacgcgtcgt
tgtctgcaagtccgcgagcagacgcaggccgaccaatcggccacacacgactggcagccg
ttggagggcacgatcgacggcttcgagcacgaggacggcatccgcaacctgctgcgggtg
acccgctacccggccggcacggaccggaacgccgaccaggtgtacgtgctcgaccagatg
ctcgaagccagcagctag

DBGET integrated database retrieval system