KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03572Help
Entry
PXO_03572         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
  KO
K06910  uncharacterized protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-ProteinID: ACD56951
UniProt: A0A0K0GFJ9
Position
301894..302505
Genome map
AA seq 203 aa AA seqDB search
MRLTSNSIENGKPIAVEFAAGTPDGFAPNRNPHLAWSEVPTGTQSFALLCLDPDVPTVPD
TVGRDDLQIPVEQPRTDFVHWAMADISADVHEIAAGSCSDGFVVKGKQQPPGPAGARQGL
NSYTQWFAGNADMAGDYRGYDGPYPPFNDLRMHRYFFRVFALDVAKLSLPDRFTAADVLS
AIQGHVLAEAALHGTYTLNPALR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgaccagcaacagcatcgaaaacggcaagcccatcgctgtggaatttgccgcc
ggtacgccggatggcttcgcacccaaccgcaacccgcacctggcctggagcgaggtgccg
accggtacgcagtcattcgcgctgttgtgcctggacccggatgtaccgaccgtgcccgac
accgtcggccgcgacgacctgcagattccagtcgagcagccacgcaccgatttcgtgcat
tgggcgatggccgatatctccgccgatgtgcatgagattgccgccggcagctgcagcgac
ggctttgtggtcaagggcaagcagcaaccgcccggcccggccggtgcccggcagggcctg
aattcctacacgcagtggttcgccggcaatgccgacatggccggcgactaccgcggctac
gacggcccgtacccgccgttcaacgacctgcgcatgcaccgctatttcttccgggtgttc
gcgctggacgttgccaagctcagcctgcccgaccgcttcaccgccgccgacgtgctgtcg
gcgattcagggccatgtgctggcggaagccgcgttgcatggcacctacacgttgaaccca
gcgctgcgctga

DBGET integrated database retrieval system