KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03573Help
Entry
PXO_03573         CDS       T00763                                 

Definition
(GenBank) tetratricopeptide repeat family
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_19 TPR_2 TPR_16 TPR_14 TPR_1 TPR_17 TPR_11 TPR_12 TPR_8 ANAPC3 TPR_9 HrpB1_HrpK TPR_15 TPR_4
Motif
Other DBs
NCBI-ProteinID: ACD56950
UniProt: A0A0K0GG21
Position
299627..301699
Genome map
AA seq 690 aa AA seqDB search
MQDAILQALRRNAADDAVALAREWATAAPDDVAAHRWLAVALQQQGQPGLALGSIDTALM
LTPEDADLHLLRAGALLATRDLSAADAALSRTTALDPNQFNAYVMQAHLAVARGDLDEAE
RLSRTAARLVPEHPQLLAVDGVVEMRRSQSDRALSLLTRAAEQLPDDARVLFSLGFAYLQ
KEHFAFAERAFERVIELNPPGTALRAFIAQLAQRQGRLDDALAAMQGVLEQPGGDLPAMR
RLAGEMELQAGRPDQAAAHLRLALAHWPADRRTLHALLTAWVRLGAVDDARDTLDAALAT
SATAHDLWLARLAVEPVGGPQAQAVIERWLLAMPEHLPALEALMRVHDMQGHGDAAEMVA
RQIVAVEPGRISGEQRIVEALLERDPLAAIACVESLIESLPAPQQTVLRPWLGNVQDRAG
QPDAAVGTWMQFHREQAQHRLPLPPQAAKQPTQWPALVTIPDTVTARPLFVWGTPGSHVE
RLIAVMDAATPLVRGDRYGTTPPSDALQSYRTLDQLASGELAPTALVEGWKAQLPRRGID
DGNVIDWLLWWDNTLLTALRPHLPEGRLAIALRDPRDMLLDWLSAGASAPLALQSPQQAA
DWLLIALEQLAVLHERDLYPHRIIRLDGIENDPQGISTALEQAFGLNFPLVEPRGPTRLA
AGRWRNYRGVLGAQFDLLTLIAVRFGYPQD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgccattcttcaagccctgcgccgcaatgcggccgacgatgcagtggcgctg
gcccgcgagtgggcaaccgccgcgcccgacgacgtcgccgcgcaccgctggctggcggtg
gcgctgcagcagcaagggcagccggggctagcgctgggcagcatcgacaccgcgctgatg
ctgacccccgaagatgccgacctgcatctgctgcgtgccggtgcgttgttggcgacgcgc
gatctgtctgccgccgatgcggcgctgtcgcgcactaccgcgctggatccgaatcagttc
aatgcttacgtgatgcaggcgcatctggcggtggcacgtggcgatctggacgaggccgag
cggctcagccgcactgccgcgcgcctggtgccggagcatccgcaattgctggcggtcgat
ggcgtggtggagatgcgccgcagccagagcgaccgcgcgctgtcgttgctcacccgcgcc
gccgagcagttgcccgacgatgcacgcgtgctgttttcgctgggctttgcgtatctgcag
aaagagcattttgcattcgccgagcgcgcgttcgagcgcgtgatcgagctcaatccgccg
ggcaccgcgctgcgcgccttcattgcccagctggcccagcgccagggccgtctggacgac
gcgctggcggcgatgcagggcgtgctcgagcagcccggcggcgatctgccggccatgcgc
cggcttgccggcgagatggaactgcaggccggtcgccccgatcaggccgccgcccatctg
cgcctggcactggcgcactggccggccgaccgccgcacgctgcatgcgctgcttaccgcc
tgggtgcggctgggcgcggtggacgatgcgcgcgacaccctggatgcggcgctggccacg
tcggccacggcgcacgacctgtggctggcccgcctggcggtggagccggtcggtgggccg
caggcgcaggcggtgatcgagcgctggctgctggccatgcccgagcacctgccggcgctg
gaggcgctgatgcgcgtgcatgacatgcagggccatggcgacgcagcggagatggtggcg
cgccagatcgtggcggtggagccgggccgcatcagcggcgagcagcgcattgtcgaagcc
ttgctggagcgcgacccgctggcggccatcgcctgcgtcgaatcgttgatcgaatcgctg
cctgcgccgcagcagaccgtgctgcggccgtggctgggcaatgtgcaggaccgcgccggc
cagcccgatgccgccgtgggcacctggatgcagttccaccgcgagcaggcccagcaccgg
ttgccgttgccgccgcaggccgccaaacagccgacgcagtggcctgcgctggtgaccatc
cccgacaccgtcaccgcgcgcccgctgttcgtgtggggcacgcccggctcgcatgtcgaa
cgtttgatcgcggtgatggacgcggccaccccactggtgcgcggcgaccgctatggcacc
acgccgccgtcggatgcgctgcagagctaccgtacgctcgaccagttggcctccggcgaa
ctggcaccgacggcgctggtggaaggctggaaagcacaactgccgcgtcgcggcatcgac
gatggcaacgtcatcgactggctgctgtggtgggacaacaccttgttgaccgcgctgcgc
ccgcatctgcctgagggccggctggcgattgcgctgcgcgacccgcgcgacatgctgctg
gactggctctcggccggtgcgtccgcgccgctggcactgcaatccccacagcaggccgcc
gattggttgctgatcgcgctggaacagctggccgtcttgcacgaacgcgatctgtacccg
caccggatcattcggctggacggtatcgaaaacgatccgcagggcatttccaccgcgctg
gaacaggcgttcgggctgaacttcccgctggtcgaaccgcgtggcccgacgcggttggct
gccggtcgctggcgcaattaccgcggcgtgcttggcgcgcagttcgatctgctcacgctg
attgccgtgcgcttcggctacccgcaggactga

DBGET integrated database retrieval system