KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03593Help
Entry
PXO_03593         CDS       T00763                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop01040  Biosynthesis of unsaturated fatty acids
xop01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PXO_03593
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PXO_03593
Lipid biosynthesis proteins [BR:xop01004]
 Desaturase
  First
   PXO_03593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ACD56930
UniProt: A0A0K0GG00
Position
277023..278240
Genome map
AA seq 405 aa AA seqDB search
MEMPMLSEPLIDFLTSGVARLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDFHPVI
AHFFRFWTWFTTSMISREWVAIHRKHHAKVETEEDPHSPQSKGISQVFWRGVELYREART
QRADIEQYGKAAPTDWIERHLYTPHANAGPVALLVINSVLFGLPGIALWAVQMAWIPFWA
AGVVNVLGHWWGYRNFESADTSTNLTPWALRIGGEELHTHHHAFPSSARFSMRRWELDIG
WVVIRSVQAFGLAKVLRVAPSLDIRPNIAVLDADTLKPLLSHRFQAMTDYQRNVLKPALR
EEAAATGAKLRELLPRRLRKGLVDDGRWLKPEARAQLQTWVAQRPRMRTLVEYRARLTAV
LEARSHDASERLRQLQQWCHEAEASGNAALQAYAARLKGDALSGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggagatgccgatgttgtccgaaccgctcatcgactttttgacgtcaggcgttgcaagg
ctgggtgtgtggggcatgctggcggtgctgctggtgttcactcagctcaccatctttgcg
gtgaccttgtacctgcatcgcagccaggcgcatcgcggtgtggatttccacccggtcatt
gcgcattttttccgcttctggacctggtttactacctcgatgatcagccgcgagtgggtg
gcgatccatcgcaagcaccacgccaaggtcgagaccgaagaagacccgcacagcccgcag
agcaaaggcatctcgcaggtgttctggcgcggcgtggagttgtaccgcgaggcgcgcacg
cagcgcgccgatatcgagcagtacggtaaggccgcgccgaccgactggatcgagcggcac
ctgtacacgccgcatgccaacgcaggcccggtcgccttgctggtgatcaactcggtgttg
ttcgggttgccgggtatcgcgttgtgggcggtccagatggcgtggattccgttctgggcc
gccggtgtggtcaacgtcctgggccactggtggggctaccgcaacttcgaatcggccgac
acctccaccaacctcacgccttgggcgctgcggatcggtggcgaagaattgcacacccac
catcatgccttcccgagttcggcacgcttttcgatgcggcgttgggagctggatatcggt
tgggtcgtcattcgcagcgtgcaggcgtttggcctggccaaggtgttgcgggtggcgccg
tcgctggatatccgaccgaatatcgccgtgctcgatgccgatacgctcaagccgctgttg
tcgcaccgcttccaggcaatgaccgactatcagcgcaatgtgctcaagcctgcattgcgc
gaagaggcggctgctaccggcgccaagctgcgcgagttgctgccgcgccgcttgcgcaag
ggtctggtcgatgacgggcgctggctcaaaccggaggcacgcgcgcagttgcagacctgg
gtggcgcagcgtccgcgcatgcgcaccctggtcgagtaccgtgcgcggctgacggccgtg
ctggaagcgcgcagccacgatgcctccgaacggctcaggcagttgcagcagtggtgccat
gaggccgaagccagcggcaatgccgccttgcaggcgtatgcagcgcggctcaaaggggat
gcgctgagtggcgcctaa

DBGET integrated database retrieval system