KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03669Help
Entry
PXO_03669         CDS       T00763                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xop00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183901..186084)
Genome map
AA seq 727 aa AA seqDB search
MTAVSNRWDPGVIRALAEARHGDAFAVLGAHRTDTGRVLRTYLPGAERVSAVLDDGQTIA
LEAGPEPGLFAGDLPAQGGYRLRIGWPGGEQDTADPYAFGPQLSDFDLHLISEGHHLQLA
DALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWELFVPDV
GPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPYQWSDDGWMATRARRQ
AHDAPMSVYEMHAGSWLREEGVDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGSWG
YQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEH
ADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRDYSRNA
GEWVPNIHGGRENYETIAFLRRLNALVREHTPGAVMIAEESTAFPGVTADVAHGGLGFHY
KWNMGWMHDTLHYASLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRM
PGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDSGLPWHLLDDPRHRGVQT
LVRDVNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVINFTPV
VQHGYRIGVPQGGQWREVFNSDAGIYGGANLGNGGIVTAEQQSMHGHAHALPLLLPPLGA
IVLTPPG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtgagtaatcgatgggatcccggcgtcatccgtgccctggccgaggcgcgc
cacggcgatgcgttcgccgtcctgggcgcgcaccgaaccgacaccggacgtgtattgcgc
acctatttgcctggcgccgagcgcgtcagcgcggtgctggacgacggccagacgatcgcg
ctggaggctggcccggagccgggcctgtttgccggcgaccttccggcgcagggcgggtat
cggctgcgcatcggctggcccggtggcgagcaggacaccgccgacccgtacgcgttcggt
ccgcaactgagcgacttcgacctgcacctgatcagcgaaggccaccacttgcaattggcc
gacgcgctgggcgccaacgtggtggaagtggacggcgtacgcggcacgcgctttgcggtg
tgggcgccgaatgcctcgcgtgttgcggtggtgggcgacttcaacagctgggacgcgcgc
cgtcatccgatgcggctgcggcaccagtccggcgtgtgggagttgttcgtgcccgacgtc
ggccccggtgcgcattacaagtaccagctgcgtggcccgcatgggcacgaactgccggcc
aaggccgacccggtggcgcgccgcgcagagcttgcgccgggcaccgcctcgatcgtggcc
gaccccacgccgtatcagtggagcgacgacggctggatggcgacgcgcgcgcgtcgtcag
gcgcacgacgcgccgatgagcgtctacgagatgcatgccggctcctggctgcgcgaagaa
ggcgtggatctggactgggatggtctggccgatcgcttgattccctatgtggccgatatg
ggctttacccatgtcgagttgatgccggtgaccgagcatccgttcggcggctcgtggggc
tatcaaccgttgggcctgttcgcgcctaccgcgcgcttcggcacgcccgacggtttcgcg
cgttttgtggaccgctgccaccgcgaaggcattggtgtgatcgtcgactgggtgcctgcg
cactttcccaccgacgcgcacggcctggcgcatttcgatggcaccgcgctgtacgaacat
gccgacccgcgcgagggtttccatcgcgactggaatacgctgatctacaaccacggccgt
cgtgaggtgtccggattcctgatcgccagtgcgatggaatttctgcagcgctaccacgtc
gatggtctgcgcgtggatgcggtggcttcgatgctgtaccgcgattacagccgcaatgcc
ggcgagtgggttcccaacatccacggcggccgcgagaactacgagaccatcgcgttcctg
cgccggctcaacgcgctggtgcgcgagcacactccgggcgcggtgatgattgccgaagaa
tccaccgcgtttcctggcgtcaccgccgatgtggcgcatggcggcctgggcttccactac
aagtggaacatgggctggatgcacgacacgctgcattacgccagtctggacccgatctat
cgccgttaccaccatggcgagctgacgttcagcatggtctacgcgtattcggagcgcttc
gtgctgccgatctcgcacgacgaagtggtgcacggcaaggggtcgttgctgggccgcatg
ccgggcgacgactggcagcgctttgccaatctgcgcgcgtatctgggtttcatgttcacc
cacccggggcgcaagttgctgttcatgggctgcgagttcggccagccgaccgagtggaac
cacgacagcggtctgccgtggcacttgttggacgatccacgccaccgtggcgtacagacg
ctggtgcgcgacgtgaaccggctgtatgtccaataccctgcgctgcatgcgcatgacgac
gacccgtcaggcttcgcctgggtggtgggcgacgatgccggcaacagcgtggtggcattc
ttgcgcaagggcaaacgtggcgatgcgcccgtgctggtggtgatcaatttcaccccggtc
gtgcagcacggctatcgcatcggcgtgccacaaggcggccagtggcgcgaggtattcaat
agcgacgccggcatttatggcggtgcgaacctgggcaatggtggcatcgtcacggcagag
cagcagtccatgcacggccacgcacacgcgctgccgctcttgttgcccccactgggcgcg
atcgtgctcacgccgcccggctga

DBGET integrated database retrieval system