KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03790Help
Entry
PXO_03790         CDS       T00763                                 

Definition
(GenBank) monooxygenase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transthyretin NAD_binding_9 DAO Thi4 NAD_binding_8 Pyr_redox_3 FAD_binding_2 Pyr_redox_2 HI0933_like GIDA TrkA_N CarboxypepD_reg FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACD57078
UniProt: A0A0K0GG56
Position
complement(449255..449947)
Genome map
AA seq 230 aa AA seqDB search
MHPAGHVDDVIIVGAGQSGLGAAFALQRERVHNVLVIDENPADQEGPWVTYARMQTLRTP
KHITCVPSLTFRAWRQAQHGSAAWDALDKIPRARWMDYLRWYRTTVRLPARIRRPMAATD
PGGGMSPLCTHVLDTANGRPAAGVPLRLFAGDTLHFEGVTHPDGRCPDLAALTLQPGRYR
LEFEVAGHLQAAGMALSDPPFLQQVPIAFGIADDGHYHVPLLLSPYGYST
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgcatccggccgggcacgtcgacgacgtgatcatcgtcggcgccggtcagagcggcctg
ggcgcggcgttcgcgctgcaacgcgagcgtgtgcacaacgtgctggtgatcgacgaaaac
ccggccgaccaggaaggcccttgggtgacctacgcgcgcatgcagaccttgcgcacgccc
aagcacatcacctgcgtgccatcgctcaccttccgcgcgtggcggcaggcgcagcacggc
agtgccgcatgggacgcgctggacaagattccgcgcgcccgctggatggactatctgcgc
tggtatcgcacaacggtgcggttgccggcccgaattcgtcggccaatggccgcaaccgac
ccaggcggtggcatgagcccgctctgcacgcatgtgctggacaccgccaacggccgcccc
gccgccggcgtgccgctgcgcctgttcgccggcgacacgctgcacttcgaaggcgtcacc
catccggacggccgctgcccggacctggccgcactcacactgcaacccggccgctaccgg
ctggaattcgaggtggccggccatttgcaggccgccggcatggcattgtccgacccaccg
tttctgcaacaggtgccgatcgccttcggcatcgccgacgacggccactaccacgtgccg
ctgctgctctcgccatacgggtactccacttag

DBGET integrated database retrieval system