KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03792Help
Entry
PXO_03792         CDS       T00763                                 

Definition
(GenBank) ISXo3 transposase ORF A
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_Tnp_1_3 ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ACD57076
UniProt: A0A0J9WWG1
Position
448110..448457
Genome map
AA seq 115 aa AA seqDB search
MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAVTTAEVTDRQGALEAL
KRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRSELHTFKVMPKR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtggacgcgcagagcgtgaagaacagtgatacagccggtcagaaaggctatgac
gcgggcaagaaggtatcggggatcaagcgccacatcgcggtggatacgcaaggctttcca
catgccgttgcggtgaccacggcggaagtcaccgatcgtcaaggtgcgctggaggcattg
aaacgctgccgatcgggtttaggtcgggtgaaacgcctgctgtgcgacagcggctacacc
ggagatcccttcgccgagggcgtacaggacattctgggcaagcatgtcaccgtacagatt
gccaagcgcagcgagctgcataccttcaaggtcatgcccaagcgctag

DBGET integrated database retrieval system