KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03837Help
Entry
PXO_03837         CDS       T00763                                 

Definition
(GenBank) membrane protein, putative
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACD57037
UniProt: A0A0K0GGA4
Position
complement(397783..398682)
Genome map
AA seq 299 aa AA seqDB search
MSEIRKVPASAGAEWLLTGFSLLKRAPLALGALGVIWSVAASLVVSLSVLVPLLGPALQF
LLLLAGPLFMGGLLWAIREVDEGRRAKPSHLLHGLQDGRAPHLLVSLLPQLIAGLLLGVL
LLVMIGSSGLQQLSEVMIKINQISQSGAQPDPVQIEQLAASLPAGRILLWLLLTIATFAA
MTLALFVMPPQVMFNRSTGGHALRESLRASLHNLPAMLVFFVLAFIAIFAIYFGVTIVAM
IVSLVAGKVAAAWLAQLLLMAVLMPVFGGSVYAAWKQMFSPEGTIAQPAPPSRPDVFVA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattcgtaaggtgccggcatctgccggcgcagagtggttgttgaccggtttc
tcgctgttgaagcgggcgccgctggcgcttggcgcgctgggggtgatctggagcgtggct
gcctcgctggtggtgtcgctgtcggtgctggtgccgctgctgggcccggccctgcagttc
ctgctgctgctggccggcccgctgttcatgggtggcctgctgtgggcgatccgcgaagtg
gacgaaggccgcagggccaaaccgtcgcatctgctgcacggcctgcaagacggccgcgcg
ccgcacctgctggtgtcgctgctgcctcagctgatcgccggcctgctgctgggcgtgctg
ctgctggtgatgatcggctccagcgggctgcagcagctgtcggaggtgatgatcaagatc
aaccagatcagccagtccggcgcgcagccggacccggtgcagatcgagcagcttgccgcc
agcctgccggccgggcgcatcctgctgtggctgctgctgaccattgccaccttcgcggcg
atgacgctggcgctgttcgtgatgccgccgcaggtgatgttcaaccgcagcaccggcggc
cacgcactgcgcgagagcctgcgcgccagcctgcacaacctgccggcgatgctggtgttc
ttcgtgctggccttcatcgcgatcttcgcgatctatttcggtgtgacgatcgtggcgatg
atcgtctccctggtggccgggaaggtcgctgcggcgtggctggcccagctgctgctgatg
gccgtactgatgccggtgttcggcggctcggtctacgccgcctggaagcagatgttcagc
cctgaagggacaatcgcccagccagccccgccctcacggccggatgtgtttgttgcctga

DBGET integrated database retrieval system