KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03839Help
Entry
PXO_03839         CDS       T00763                                 

Definition
(GenBank) sec-independent protein translocase
  KO
K03117  sec-independent protein translocase protein TatB
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03060  Protein export
xop03070  Bacterial secretion system
Module
xop_M00336  Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:xop00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    PXO_03839
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    PXO_03839
Secretion system [BR:xop02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   PXO_03839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TBPIP YjbH ApoLp-III TcpS Kre28
Motif
Other DBs
NCBI-ProteinID: ACD57035
UniProt: A0A0K0GG01
Position
396343..396879
Genome map
AA seq 178 aa AA seqDB search
MRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNKQQQVEQGARALHDDV
SRDIDIRSSATPVATPLELAHADLSASAHVDAAAGAAAGAGPAPAPAPAAPVIAQAQPIA
PAPHQTLVPAPHDTIVPAPHAAHLSSAPAPPVTVAPVDAGTSASPTPSEPTKIQEKQP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgcgcgcatgcagtgggattcggtcaagcaggaactggaacgcgaactcgag
gccgaagagctcaagcgcagcctgcaggatgtacaggcctcgctgcgcgaggccgaggac
cagttgcgcaacaagcagcagcaagtcgagcagggcgcccgcgcgctgcatgacgatgtc
agccgcgacatcgacatccgcagcagcgcaacgccggtggcaacgccgctggagctggcg
catgccgatctgtctgccagcgctcatgtcgatgcggcagcaggcgcagcggctggggct
ggccctgcacctgcacctgcacctgccgcgccggtgattgcgcaagcccaacccattgcg
ccagcgccgcatcaaaccctggttccggctccgcacgacaccatcgtgccggcgccgcac
gccgcgcatctcagcagcgcgccagcgccgccggtgaccgtcgcgccagtcgatgccggc
acatcggcctcgcccacgcctagcgagccgaccaagatccaggagaaacagccgtga

DBGET integrated database retrieval system