KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03852Help
Entry
PXO_03852         CDS       T00763                                 

Definition
(GenBank) alpha-glucuronidase
  KO
K01235  alpha-glucuronidase [EC:3.2.1.139]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.139  alpha-glucuronidase
     PXO_03852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_67M Glyco_hydro_67C Glyco_hydro_67N Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ACD57022
UniProt: A0A0K0GG13
Position
complement(383333..385528)
Genome map
AA seq 731 aa AA seqDB search
MKRHGADVGVFPLQWLLWLALLSGGLLATVSARAEDGYDLWLRYQPLANAAQLRDNASEL
VIIGDSPTLHAARDELARGLQGLLGNTPPHVDAVTRDGAIVLGAASAPQITALKLDTRQL
GREVYLIRSANGDGHRITLIVGGSDIGVLYGTFYLLRLLQTGKSLAALDVRASPRLQLRM
LNHWDNLDGLVERGYAGASLWNWQTLPGYLDPRYTDYARANASLGINGTVLNNVNAKAWS
LTPHYLDKAAALATVFRPYGVGVFLSARFSAPIEIGGLKTSDPLDPQVQRWWRDTADAIY
ARIPDFGGFLVKANAEGQPGPQDYGRSHADGANLLADALAPHGGVVMWRAFVDSHEQPDD
RAKQAYSEFVPLDGAFHDNVIVQVKNGAIDFQPREPFHPLFGAMRKTPLIPEYQITKEYL
GFSTHLAYLGTLFSETLQADTHARGKGSTVARTVDGSLFADIKRTRLTGIAGVANIGADR
NWSGSIFDQANWYAYGRLAGDPQLSPQAIAQEWARMTFSNDPAVVEPVVGMMLRSREAVV
DYMTPLGLHDLMGRGHHYGPAPWDAGSERPDWDPVYYHRADRDGIGFDRSASGSNAVAHY
APPVARVFGDVQRVPEPLLLWFHHVPWDHRMASGRPLWDELVWHYDHGVNEVAAMRATWQ
GLAGKIDAQRYQQVADFLAIQQREAQWWCDASIAYFQSVSGRPLPAGVSPPAHPLAYYQA
LTFPYAPGNPT
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcatggcgccgacgtcggtgtatttccgctgcagtggttgctgtggctggcg
ctactgagtggcggcctgctggccaccgtcagcgcgcgtgcggaggacggctacgattta
tggttacgctaccaaccgctggccaatgccgcgcaattgcgtgacaacgccagcgagttg
gtcatcattggcgattcgcccaccctacacgccgcacgcgatgaactggcgcgtggcttg
cagggattattgggaaacacgccgccccacgtggacgcggtaacgcgcgatggcgcgatt
gtgctgggcgccgccagcgcacctcagatcacggccctgaaactcgacacacgccagttg
ggccgcgaggtctatctcatccgtagcgccaatggggatgggcatcgcattaccctcatt
gtcggcggcagcgatatcggtgtgttgtacggcacattctacctgttgcgcctgcttcag
accgggaaatcgcttgcagccttggacgtgcgtgcatcgccacgcctgcaactgcgcatg
ctcaatcattgggacaatctcgatgggctggtggaacgtggctatgccggcgcgtcgctg
tggaactggcagacgctgcccggctatctggatccgcgctacaccgactacgcgcgtgcc
aacgcgtcgctgggcatcaatggaaccgtgctcaacaacgtcaatgccaaggcatggagc
ctgacaccgcactatctggataaagccgcagcgctggcgacggtttttcgcccctatggc
gttggcgtgtttctcagtgcgcgcttcagtgcccccatcgaaatcggtggtttgaaaact
tccgacccgctggacccgcaggtgcagcgctggtggcgcgacacagccgacgccatctat
gcgcgcattccggattttggcgggtttctggtcaaggccaacgccgaaggccagcccggc
ccgcaggactatggacgcagccacgccgatggcgcgaacctgctcgccgatgcactggcg
ccgcatggcggggtggtgatgtggcgcgcgttcgtcgactcgcatgagcagccggacgac
cgcgccaagcaggcgtacagcgagttcgtgccgctggatggcgcctttcacgacaacgtg
attgtgcaggtaaaaaacggtgccatcgacttccagccgcgcgagccgtttcatccgctg
ttcggtgcgatgcgcaagacgccgttgatcccggagtaccagatcaccaaggaatatctg
ggtttttccacgcatctggcctatctggggacactgttttccgaaaccttgcaggccgat
acccatgcgcgcggcaagggctcgaccgtcgcaaggacggtggatggcagcctgttcgcc
gatatcaaacgcacgcggctgaccggcattgccggtgtggccaatatcggcgccgatcgc
aactggagcggctcgatcttcgatcaggccaactggtatgcatacgggcggctggcaggg
gacccgcaactgtcgccgcaggccattgcgcaggaatgggcgcgcatgacgttttccaac
gatccggcggtggtcgagccagtggtcggcatgatgctgcgttcgcgcgaggccgtggtg
gattacatgaccccgctcggcctgcatgacctgatggggcgcggccaccattacggcccg
gcaccctgggatgccggcagcgaacgcccggactgggacccggtgtattaccaccgcgcc
gaccgcgacggcattggcttcgaccgcagcgcgagcggcagcaacgccgttgcgcactat
gcgccgccggtggcgcgcgtgttcggcgacgtgcagcgtgtccccgagccgttgctgctg
tggttccatcatgtgccgtgggatcaccgcatggcctctggcaggccgctatgggacgag
cttgtgtggcattacgaccatggcgtcaatgaggtggctgcgatgcgcgcgacctggcag
ggcctggccggcaagatcgatgcacagcgctaccagcaggtggccgatttcttggcgatc
cagcagcgtgaggcgcagtggtggtgcgatgccagcatcgcttattttcaaagtgtgtcc
ggtcgtccgctgcccgcaggcgtcagcccgccggcgcatccattggcgtattaccaggca
ctgacatttccgtatgcaccggggaatccgacgtga

DBGET integrated database retrieval system