KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03861Help
Entry
PXO_03861         CDS       T00763                                 

Definition
glycosyl transferase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PXO_03861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369292..370269
Genome map
AA seq 325 aa AA seqDB search
MLKLRYPLTLVLLLGACASAVAGPIAAGKRRVLGSAYSPQQAQGFTNYWNADVPENAGKW
GSVEAVRGQMNWGPLDEAYQLAKRNHMQFQFHVGLWGSQQPTWVRDLPPNEQRAAIEHWF
AAIAQRYPDIDLMQVANETLPGHNQPDNRRADSGNYMRALGGTGATGVDWVLEAFRLARK
YFPHTKLMINDYNVTEYNDQARQYLHTIQLLQQEHLIDAIGIQGHLSSNGPSVAVQRANL
DLLASTRLPIYITEFDLDGRTDAQQLAAWQRFFPMFWEHPAVRGVNLWGFRHGMWRDNEG
AYLINYDGSERPALTWLRSYVASRP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactccgttacccgctcacgcttgtgctgttgctgggcgcttgtgcgtccgct
gttgccgggcctatcgctgccggcaaacgacgcgttctgggcagcgcctacagcccacag
caagcgcagggcttcaccaactactggaacgccgacgttcccgaaaatgccggcaaatgg
ggcagcgtcgaagccgtgcgcggccagatgaactggggcccgctcgacgaggcttaccag
ctggccaagcgtaaccatatgcagttccagttccatgtcgggctctggggctcgcagcag
ccgacgtgggtacgcgacctgccgccgaatgaacagcgtgctgcaatcgagcactggttc
gccgccatcgcgcagcgctatcccgatatcgatttgatgcaggtggccaatgagacgctg
ccgggtcacaaccagccggacaatcgccgcgccgattcgggcaattacatgcgggcactg
ggcggtaccggggcgaccggcgtggactgggtgcttgaggcattccgcctggcacgcaag
tatttcccccataccaagttgatgatcaacgactacaacgtcaccgagtacaacgaccaa
gccaggcagtatctgcacaccatccagctgttgcagcaagaacatctgatcgatgcgatc
ggtatccaggggcacctctcgagcaacggcccctcagttgcggtgcagcgcgccaacctc
gacctgctggcatccaccaggttgccgatctacatcaccgagtttgacctggatggccgt
accgatgcccagcagctggcagcctggcagcgcttcttcccgatgttctgggagcacccg
gccgtgcgcggtgtgaacctgtggggtttccgtcacggtatgtggcgcgacaacgaaggt
gcctatctgattaattatgatggcagcgaacgcccggcattgacctggctacgcagctac
gttgccagcaggccatga

DBGET integrated database retrieval system