KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03863Help
Entry
PXO_03863         CDS       T00763                                 

Definition
glycosyl transferase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368060..368875
Genome map
AA seq 271 aa AA seqDB search
MGQCGSDARPDDWSTLDAAYRFAQANGMPFQMHVMMWGNQQPEWIKSVRAVEQRREIAPW
FATVAQRYPDIALLEVVNDPLNDPPSKADTGGGNYLQALGGSGDSGWEWGLQAFRLARQH
VPHNKRMINDYSITNSAQATQKYLQIVRLLQREHLVDAIGVQKHAFETTPNVAMSVHRDN
LDALAATCLPIYITEFDLDGPTDTQQLADYQRVFPLFWERPAMHGITLWGFRPGVWRDKE
AAYLIRADGTERPALTWLRDYVAAHPGTPTP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggggcagtgtggaagcgatgcgcgaccagatgattggagcacgctggatgctgcttac
cggtttgcgcaggccaacggcatgccgttccagatgcacgtgatgatgtggggcaaccag
cagccggagtggatcaagagcgtgcgggcggtcgaacagcgccgcgagatcgcgccatgg
tttgccactgttgcgcagcgctacccggacatcgcgctgctggaggtagtgaacgacccg
ctcaacgacccgccgagcaaggccgataccggtggcggcaattatctgcaggcgctgggt
ggcagcggcgacagtgggtgggaatgggggctgcaggcgtttcggcttgcgcgccagcat
gtcccgcacaacaagcggatgatcaacgactacagcatcaccaatagtgcgcaggccaca
cagaaatatctgcagatcgtgcggttgctgcagcgcgagcacttggtcgatgccatcggc
gtgcagaagcacgccttcgagaccacaccgaatgtggcgatgtcggtgcatcgcgacaat
ctggatgcgttggctgccacctgtttgccgatctacatcaccgagttcgatctggacggg
cccaccgatacgcagcagctggccgactaccagcgcgtgtttccgctgttctgggagcgc
ccggccatgcatggcatcaccttgtggggctttcggcccggcgtgtggcgcgacaaggaa
gctgcctacctgatccgcgccgatggcaccgaacgtcccgcgctcacgtggctgcgtgac
tacgttgcagcccatcccggcacacctacgccatga

DBGET integrated database retrieval system