KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03873Help
Entry
PXO_03873         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACD57004
UniProt: A0A0K0GFR0
Position
358261..358437
Genome map
AA seq 58 aa AA seqDB search
MTTQKERVGGTDAVPIFKMQETTRDGELTKYVVGDTGVAFDSLEGAQAAAKDLGTLNG
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcagaaagaacgcgtcggcggcaccgacgcagtgccgattttcaagatgcag
gaaaccacacgcgacggcgagctgaccaagtacgtggtcggcgacaccggcgtggccttc
gacagcctggaaggcgcccaggcggccgccaaggatctgggcacgctcaacggctga

DBGET integrated database retrieval system