KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03879Help
Entry
PXO_03879         CDS       T00763                                 

Definition
(GenBank) oxidoreductase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2
Motif
Other DBs
NCBI-ProteinID: ACD56997
UniProt: A0A0K0GFQ5
Position
353226..354302
Genome map
AA seq 358 aa AA seqDB search
MNLAFSPKSTSPLPARLARRLVSPQLFDFWATRINPLWTLERPMARLVERSPASRDAVTL
VLQPNSHWRGLQAGQHVSLGVEIDGRRLLRSYSPTVLVDGRLAITVKAIEGGLVSRFLTH
DAALGTVVSLDPAFGDMLLPSTPTPLLLLAAGSGITPMRALLQAAAQAGMPMDVDLLYWV
RQRDEACFVDEFAALAAAHPRLRVQLLTTREGEMPAARIDTYPLDQISALEQRHAMACGP
GGFVQAARERLQGRVAAFQAEAFSVPALDESEAGQVQVQLSRSGRTLTLPRGQSLLEGLE
AQGLRPNHGCRMGICNTCACARQSGTTRHLLTGERSNEPTAPVRLCISAPSTDLILDL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcattttctccaaagtccacgtccccgctgccggcacgcctggcgcgccgg
ctggtgtcgccgcaactgttcgatttctgggcaacccggatcaacccgctgtggacgctg
gaacggccgatggcacgcctggtcgagcgcagccctgccagccgcgatgcggtgaccctg
gtgttgcagcccaacagccactggcgcggcttgcaggccggccagcatgtgagcctgggc
gtggagatcgacggccgccgcttgttgcgcagctacagcccgaccgtgctggtcgacggc
cgcctggcgattactgtcaaggcgatcgagggcgggctggtcagccggttcctgacgcac
gatgcggcgctgggcacggtggtgtcgctggacccggccttcggcgacatgttgttgccg
agcacgccaaccccgctactgctgctggccgccggctcgggcatcacgccgatgcgcgcg
ttgctgcaggccgctgcgcaggccggcatgccgatggacgtggacctgctgtactgggtg
cgtcagcgcgacgaagcctgcttcgtcgacgaattcgccgcgctggccgccgcgcatccg
cgcctgcgcgtgcagttgctgaccacccgcgaaggcgagatgccggccgcacgcatcgac
acctatccgctggatcagatttccgcgttggagcagcgccacgcgatggcatgcggcccg
ggcggttttgtgcaagccgcgcgcgaacgtttgcaagggcgcgtggctgcatttcaggcc
gaagccttcagcgtgccggcactggacgaaagcgaagcggggcaggtgcaggtccagctg
tcacgcagcggccgtacgctcacgctgccgcgcggccagtcgctgctggaagggctggaa
gcgcaaggcctgcggcccaaccacggctgccgcatgggcatctgcaacacctgcgcctgc
gcgcgccagtccggcaccacgcgccacctgctcaccggtgagcgcagcaacgaacccacc
gcaccggtccgcctgtgcatcagtgccccgagcactgacctgatcctggatctgtaa

DBGET integrated database retrieval system