KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03881Help
Entry
PXO_03881         CDS       T00763                                 

Definition
(GenBank) ISXo3 transposase ORF B
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_Tnp_1_2 DDE_5 DDE_Tnp_1_3
Motif
Other DBs
NCBI-ProteinID: ACD56995
UniProt: A0A0K0GFY8
Position
351944..352420
Genome map
AA seq 158 aa AA seqDB search
MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAVTTAEVTDRQGALEAL
KRCRSGLGRVKCLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRSELHTFKVMPKRWSVER
SFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtggacgcgcagagcgtgaagaacagtgatacagccggtcagaaaggctatgac
gcgggcaagaaggtatcggggatcaagcgccacatcgcggtggatacgcaaggctttcca
catgccgttgcggtgaccacggcggaagtcaccgatcgtcaaggtgcgctggaggcattg
aaacgctgccgatcgggtttaggtcgggtgaaatgcctgctgtgcgacagcggctacacc
ggagatcccttcgccgagggcgtacaggacattctgggcaagcatgtcaccgtacagatt
gccaagcgcagcgagctgcataccttcaaggtcatgcccaagcgctggagtgtcgaacgc
agctttgcctggctggagaagaaccggaggctatggaagaactgcgagcgaaggctcaat
accagcttgcagttcatccacctggcgttcctggcactgctgctcaggagatcgtga

DBGET integrated database retrieval system