KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03882Help
Entry
PXO_03882         CDS       T00763                                 

Definition
(GenBank) ISXo8 transposase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_5 DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ACD56994
UniProt: A0A0K0GFW6
Position
complement(350174..351556)
Genome map
AA seq 460 aa AA seqDB search
MLQIIVSLCHYWKTFRPRGRAVLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLL
PGGRKSVEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPTLSRKSAACH
WIVDDTGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWA
QDTVRRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSER
GLLYMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQSLPART
YRQVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQT
PVKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
KKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaaataatcgtatctttgtgccactattggaagaccttcaggccgcgcgggaga
gctgtgctgaataggtcactggaagtgcgttttgaacagtacggggaagtagttgctgcc
gccctgtcccatgcggatcgcaaacagcccgcacactggtacctgaaggggttgctactg
cctggagggcgcaagagcgtggagcccatggccgcgcgggtgcacccgcagaacgtgcgc
tcagcccatcaatcgatgcaccatctggtggccgatgccgactggagcgatcaagcgctg
ctggcggcggtggcggcacaggtgctgccgaccctgagcaggaagagcgcagcgtgtcac
tggatcgtggacgacacgggattttcaaagaagggggtgcattcggtcggtgttgcacgc
cagtactgcggccgccttggcaagacggacaattgccaggttgccgtgagtttgtcgatc
gccaacgaacacggcagcctgccagtgggctatcggctgtatcttcccgagcagtgggct
caggacactgtgcggcgcaagaaggcaggcgttccggatcaggtcgtgtttcagaccaag
acagcgctggccatggatcagatcgacagcgcgctggcgacagggattgcggcaggcgtc
gtgctagccgatgcggcctacggcaccgagacccactggcgagaccagctcagcgaacgc
ggcctgctgtacatggtcggcgtccgcagcaacacgaaggtctggtggggatcgcaccaa
cctgcgcccatgccgccagccagccctaagggcggtcggccccgcacacgaccgatgcgc
gatagcgcacatgcgccgatctcggtacatgaagtcgcgcagagcttgcccgcaaggacg
tatcggcaggtcagctggcgccagggcagcgacgcaacgctcagttcgcggttcgcggcg
gtgcgggttcgtgccgcacacaatcgccaggcacatgacgagcagtggctgctgatcgag
tggccgccgggagagtccgagccccgccactactggttctcgacgcgaccaaagcaaacg
ccggtcaagacactggttgccacggcacaaggccgatggcggattgaacgcgattatcag
gagctgaagtcggagttgggcctgcatcactatgaagggcgtaactggcgtggttttcac
catcacgccagtctgtgcatcgccgcatacgggttcttgatgcgcgagcgcctgcgcagt
aaaaaaaactccgtcgcattcaagatgcctgcagtatccaaaagcgtccgcccgcgcggg
tctggccccaatgcaacgtcaccatcccaactcgattgccacgctggccttcggactggc
tag

DBGET integrated database retrieval system