KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03887Help
Entry
PXO_03887         CDS       T00763                                 

Definition
(GenBank) transcriptional regulator MarR family
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HxlR HTH_20 HTH_34 Penicillinase_R TFIIE_alpha PadR TrmB HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ACD56989
UniProt: A0A0K0GFW2
Position
complement(347190..347648)
Genome map
AA seq 152 aa AA seqDB search
MDTAAVTNAGSDALQLDNQLCFALYSTNLAMHKLYRGLLKALDLTYPQYLVMLVLWETDE
RSVSEIGERLYLDSATLTPLLKRLQAVGLVSRTRAVNDERQVIIALTETGRALRSRAGAV
PEQVACASARSLDELRQLKQELEKLRSSLGTG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgccgcagtcaccaacgccggtagcgatgcgctgcagctcgacaatcagctg
tgctttgcgctgtattcgaccaacctggcgatgcacaagctctaccgcgggctgctgaag
gcgctggatctgacctacccgcagtacttggtgatgctggtgctatgggagaccgacgaa
cgcagcgtctccgagatcggcgagcgcctgtatctggattcggccacgctgacgccactg
ctcaagcggctgcaggcggtcggcttggtgagccgcacacgtgcggtcaacgacgagcgt
caggtgatcatcgcgctgaccgaaaccggccgcgcgctgcgcagcagggcaggcgcggtg
ccggaacaggtggcgtgcgcgtcggctcgttcgttggacgaactacgtcaactcaagcag
gaattggagaagttacgctccagcctcggcactggttga

DBGET integrated database retrieval system