KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03905Help
Entry
PXO_03905         CDS       T00763                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xop00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PXO_03905 (recD)
Enzymes [BR:xop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PXO_03905 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332239..334491
Genome map
AA seq 750 aa AA seqDB search
MNHPNLLTALNQSGALRTLDLAFAQSLQRLEPETDPQVLAGAALASLAVTSGHAGLDPVR
AAMLLDARDGPSPPFPDPADWQRCLAASRWVDQPQPEDPAAADRPLVLERGLLYLRRYRE
YERRLALGLQRIAAQTSPPFAATLEPLFAQLFPQATPLPRGEGARRAGEGKGLPEPSLQQ
EGTNPPVLSSNGTNQTAPSPTPDRQAQAAALALRRALLLVTGGPGTGKTTTIARLLLLRI
AQAHASNTPAPRIALAAPTGRAAERMAESLRAAVARAIADGIDPSLADALPTGASTLHRL
LGVIPDSPHFRHNADNPLPFDLIVVDEASMVDLPLMCKLVEAVADGTQLILLGDADQLPS
VEAGDVLAAILQAAGPGDALQPDDAQALQPLLGGAPVGSPRPVTSHIHTGGLAGHRVHLL
RGYRQADEFALAPLADAIRAGDADTALALLRSGELAGVHFHEDGEDPLALGRDALLAHWR
ALATARDPAAALRDASRLRLLTAVRAGPQGARGLNARIEQLLAETGSGARRLGGASPWFQ
GRLLLITTNSYRHGLFNGDVGICLPSDPRALPGRSDAGPSPGQGDASAVTARGHAAPSSR
PGHAGDSAHHDAPATDSRAQGPLVAWFEGDGQVRGFHPAALPAHESAFAMTVHKAQGSEF
DEVWLQLPTRDARVLSRELLYTGITRARRALHLAGSEAVIRAALARHAARISGLAWRLGA
KDDKPQPVPVPTPAPLPQPPPSAPVQGVLF
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccgaatctgctcactgcgctcaaccagagtggcgccctgcgcaccctggat
ctggccttcgcgcaaagcctgcaacgcctggaaccggagaccgacccacaggtgctggcc
ggtgccgcgctcgcctcgctggccgtcaccagcggccacgccgggctggaccccgtccgc
gctgccatgttgctggacgcgcgcgatggcccatcgcccccattcccggaccccgccgac
tggcaacgctgcctggccgcctcgcgctgggtcgaccaaccacagcccgaagacccggct
gccgccgaccgcccgctcgtcctcgaacgcggtctgctctacctgcgccgttaccgcgag
tacgaacgccgcctggccctgggcctgcagcgcatcgccgcccaaacctcgccccccttc
gccgccaccctggagccgctgttcgcacagttgttcccgcaagccacccctctcccccgg
ggcgagggtgcccgcagggcgggtgagggtaagggcctgcccgagccatccctccagcaa
gagggcacaaatccgcccgtgctatccagcaacggcacgaaccaaacagcaccatccccc
accccagatcgccaagcgcaggccgcagccctcgcgctgcgccgcgcgctactgctggtc
accggcggccccggcaccggcaaaaccaccaccatcgcccgcctgttgttgctacgcatc
gcccaggcacacgcatccaacaccccggccccacgcatcgccctggccgcacccaccggc
cgcgccgccgagcgcatggccgaaagcctgcgcgccgccgtcgcgcgcgccatcgccgac
ggtatcgaccccagcctggccgacgccctgcccaccggcgccagcacgctgcaccgtctg
ctcggcgtcattccggattccccgcacttccgccacaacgccgacaacccgctgccattc
gatctgatcgtcgtcgacgaagcctccatggtcgacctgccgctgatgtgcaaactggtc
gaagccgtcgccgatggcacccagctgatcctgcttggcgacgccgaccagctgccctcg
gtggaagccggcgacgtgctcgccgccatcctgcaggccgccggccccggcgacgcgttg
cagcccgacgacgcccaggcgttgcaaccgctgctcggcggcgcgcctgtgggcagtcca
cgcccggtcacctctcacatccacaccggcggcctggccggtcaccgcgtgcacctgctg
cgtggctatcgccaggcggacgaattcgcactcgccccactggccgacgccatccgcgcc
ggcgatgccgacaccgccctggccctgctgcgtagcggcgaactggccggcgtgcacttc
cacgaagacggcgaagacccgctggcactcggccgcgacgcgctgctcgcccactggcgc
gcgctggccactgcccgagatcccgctgccgcattgcgcgacgcaagccgcctacgcctg
ctcaccgcggtgcgtgccggcccgcaaggcgcacgtggcctcaacgcccgcatcgaacaa
ctgctggccgaaaccggctccggcgcccgtcgccttggcggcgcttcgccctggttccag
ggccgcctgctgctgatcaccacaaacagctaccgccacggcctgttcaacggcgacgtc
ggcatctgtctgcccagcgacccgcgcgccttgcctggccgcagcgacgcgggcccttcc
cccggccagggcgacgcaagtgccgtgaccgcgcgcggccacgcggcaccgtcgtcaagg
ccgggccacgctggcgacagcgcacaccatgacgcccccgccaccgacagccgtgcccaa
ggccccttggtcgcctggttcgaaggcgacggccaggtgcgcggcttccaccccgccgca
ctgcccgcgcacgaaagcgccttcgccatgaccgtgcacaaggcccaaggcagcgaattc
gacgaggtctggctgcaactgcctacccgcgacgcccgcgtactcagccgcgaactgctc
tacaccggcatcacccgcgcccgccgcgccctgcacctggccggcagcgaagcggtcatc
cgcgccgcactggcgcgccacgccgcgcggatctcggggttggcgtggcggttgggtgca
aaagacgacaagccacagcccgttccagtacccacgccagcgccgcttccacaaccgccg
ccgagtgcgcctgtgcaaggtgtgctgttctga

DBGET integrated database retrieval system