KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04029Help
Entry
PXO_04029         CDS       T00763                                 

Definition
disulfide-isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PXO_04029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(671471..673060)
Genome map
AA seq 529 aa AA seqDB search
MIAMTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIAWREGDVE
DAFAEAKESGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAW
GERFGVKAYPTIIVLRTDQSEITRLAGDADNARLAEVLRVAAKSTSTAQQLLDKALHTPQ
QLSADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAISAAEHPPA
ASAANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQALDKVYA
DTSLPISDRLGTAYARIQLARLAQGQPTEAETEGPQPPLPKDVVDTVHQRVTWATDTAKT
DEERQSTISTAAALLSDVGDGSGAEQLLLAELPRSRTPYYYMPELANLAEQRGDKKTALS
WLKKAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPDGYRQRTR
QRFASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccatgacgctgtcgcttcgacgcccctccccgtcctcgctcgcgctgctggcg
gtgctgtccatgctcactgcctgcgacaagcccgccccgcctgcggcgccttcacagacc
cacgcggcatccacaccggcgcctgctaccagcatcgcctggcgcgagggcgacgtggaa
gatgcctttgccgaagccaaggaaagcggcaagccgattctgttgtactggggcgcggcg
tggtgcccgccctgcaaccgcctcaaggcaacgctgttcaaggacccggccttcatcgcg
cgcacccagcagtttgtcgccgtgcacctggatggtgattccgaaggcgcgcaggcctgg
ggcgagcgcttcggggtcaaggcctatcccaccatcatcgtgctacgcacggaccagagc
gaaatcacccgtctggccggcgatgccgataatgcgcgcctggccgaggtgctgcgggtc
gccgcaaagagcaccagcaccgcccagcaattgctcgacaaggcgctgcatacgccacaa
cagctcagcgccgacgactgggccgtgctcggcaactatgcctggggcaccgacgaccgg
ctggtcaaacccggtgatgccgcccacgtgctcacccagctgtcgacaacggcaccacag
ccggcgctgcaacgtagcttcgccctggccgccatcagcgccgccgagcacccaccggcc
gccagcgccgccaatcgcgccttgctggaagcggtgttggccaacccggcagaagtgcgc
accaatctcagtccgctgagctatgtgcccgcgcgtctgatcaccgccgccagcaacgat
gccggcgtgcgtaccacgctctccaatgcgttgaatcaagccttggacaaggtgtacgcc
gatacgtcgttgccgatttccgaccggcttggcaccgcatatgcgcgcatccagctggca
cgtctggcacaaggccagcccaccgaagccgaaaccgaaggcccgcaaccaccgttgccg
aaagacgtcgtggacaccgtgcatcagcgcgttacgtgggccaccgacacagccaagacc
gacgaggagcgccaatccaccatcagcacggctgccgcattgctgagcgatgtaggcgat
ggcagcggagccgagcaattgctgttggccgagttgccgcgcagcaggacgccgtattac
tacatgcccgagctggcgaatctggccgagcaacgtggcgacaagaagaccgcgctgtcg
tggctcaagaaggcctatgacagcgcacaaggccctgccacgcgcgtgcagtggggcgtg
atgtatgtcaatggtctaatccggctcagccccgacgacactgccggcatcgagagcgcc
gccacgcaggtgatcggcgagctggccggccaaccggatggttaccggcaacgcacacgt
cagcgcttcgcctcgcttggcaccacattgaagacctggagcaagcagcaccgtcaggaa
ggcagtgcagtactggcgcgcctgcaacagaaaatgcactccagctgcaacagcaagaac
gccagcgaatgcgccagctggttgagttga

DBGET integrated database retrieval system