KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04233Help
Entry
PXO_04233         CDS       T00763                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xop00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
776457..777260
Genome map
AA seq 267 aa AA seqDB search
MAALSHNHTMTGLAHPDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTNDAAQ
ARDALRQALAAPIAVFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALQACGIDTVVR
PTRMDSEGLLALPLLQAPLQAVGLITAPGGRGMLAPTLEQRGARIVRADVYQRIPLRLRA
SAIQALSHALPRSVLALSSAEALTLVLQQLPSALIEKWQRRPVVASSDRMLDAAHAAGFI
HRMRAEGPLPKQLAAAAAAIVTPPRPC
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgctctcgcataatcacaccatgaccggccttgcccatcccgatgctgcctgg
accctgatctcgctgcgccccagcggcgaacatgcgccgctacggcgggcggttgcgcgg
catggcgggcgggtactggcgctgtcgccgtggcgcttgcagaccaacgatgccgcacag
gcgcgggacgcgctgcgacaggcgctggcagcaccgattgcggtgttcaccagcccggcg
gccgtgcaggcggcgcatcgtctggcgccgctgcagcgcccggcgcaggcgcactgggtg
agcgtgggcgatggcactgcgcgcgcattgcaggcctgcggcatcgacactgtggtgcgc
ccgacgcgcatggatagcgaaggcctgcttgcgctgccgctgctgcaggcgccgctgcag
gccgttgggctgatcaccgcgcccggcggacgcggcatgctggcaccaacgctggaacag
cgcggtgcgcgcattgtgcgagccgatgtctatcaacgcatcccgctgcgcttgcgcgcg
tcggccatccaggccttatcgcacgcattgccgcgcagcgtgctggccttgagcagcgcc
gaggcactgacgctggtcctacaacagctgccttccgcgctgatcgagaaatggcaacgg
cggccggtggtcgcgtccagcgatcgcatgctggatgccgcgcacgctgctggcttcatc
catcgcatgcgtgcagaaggcccactgccaaagcagcttgccgctgctgcggcagcgatc
gtgacaccaccgcgaccttgctga

DBGET integrated database retrieval system