KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04544Help
Entry
PXO_04544         CDS       T00763                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:xop00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1231332..1232201
Genome map
AA seq 289 aa AA seqDB search
MNAPGTDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWGDTIHLRVRSDGQILRI
GESLPGVAEDDDLVIRAARLLQSAAGAAAGAEIRVDKRIPAGGGFGGGSSDAATVLVALN
ALWGLALTADTLAELGLQLGADVPVFVRGRNAWAEGVGEQLTPIALPEAAYLLVDPGVHV
PTPVLFRSQELTRDAAPAKITDFASGSLLDNAFEPVLRRREPAVEAVFQALSRVGTPRLT
GSGSGCFVEFATRAAAEQALAQLPGSLRAWVVEGAAHSPLLDARDAMKV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgccgggcactgattggtcggcgtggcctgcgccggccaagctcaatctgttc
ctgcagatcaccgggcgccgcgccgatggctatcacctgctgcagaccgtgttccggctg
ctggattggggggacaccattcatcttcgcgtgcgcagcgacggccagatcctgcgcatt
ggtgagagtttgcccggcgtggccgaagacgatgacctggtgatccgcgccgcgcgcctg
ctgcaatcggcggccggcgctgcggcgggcgcggagattcgggtcgacaagcgcatcccg
gcaggtggcggtttcggcggtggatcgtcggacgcggcgactgtgttggtggcgctcaat
gccttgtggggcctggctttgacggcggatacgctggccgaattgggtctgcagctgggt
gcggatgtgccggttttcgtgcgcggtcgcaatgcctgggccgaaggcgtgggcgaacag
ctgaccccgattgccctcccggaagcggcctatctgctggtcgatccgggcgttcacgtg
ccgacaccggtgttatttcgatcacaggaattgacgcgggatgccgcgcccgcgaaaata
actgacttcgcttccggttctctgctcgacaatgcgttcgagccggttctgcggcgccgc
gaacctgccgtcgaggcagtgttccaggcgctttccagggtcggcacaccgcgattgacc
gggtcgggaagtggctgtttcgtcgaattcgccacgcgcgctgctgcagagcaggccctg
gcgcagttgccgggcagtctgcgggcgtgggtggtggagggtgcagcgcactcccctctg
ctcgacgcacgggacgcgatgaaggtttga

DBGET integrated database retrieval system