KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04648Help
Entry
PXO_04648         CDS       T00763                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xop00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:xop00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138522..1139016
Genome map
AA seq 164 aa AA seqDB search
MKVILIVAFDRNNAIGRDNDLPWKLPDDLKRFKALTLGKPILMGRKTAQSLRRALPGRLN
LVLTRSGLVPFDGMQAVASVAQAVERAVQDGAQELCVIGGGEVYRLTMERADLLAVTEVD
TAVDDADTHFPPIDPAAWSPVRRQLHPADDRHAYAFSFVDYERR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcttgatcgtcgccttcgaccgcaacaacgccatcggccgtgataacgat
ctgccgtggaaactgcccgatgatctcaagcgcttcaaagcgctgacgctgggcaagccg
atcctgatggggcgcaagacggcgcagtctctcaggcgtgcgttgccggggcggttgaat
ctggtgctgacgcgttcggggctggtgccgttcgacggcatgcaggcggtggcatcggtg
gcgcaggcggtcgaacgcgccgtgcaagacggtgcgcaggagctgtgcgtgatcggtggc
ggggaggtatatcgcctgaccatggaacgtgccgatctgctggccgtgaccgaagtggac
acggcggtagacgatgccgacacgcattttccgccgatcgacccggcggcgtggtcgcct
gtgaggcgtcagttacatcctgccgacgatcggcacgcctatgcgttttcgttcgtggat
tacgaacgccgctga

DBGET integrated database retrieval system