KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04660Help
Entry
PXO_04660         CDS       T00763                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PXO_04660
Enzymes [BR:xop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PXO_04660
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PXO_04660
Lipid biosynthesis proteins [BR:xop01004]
 Fatty acid synthase
  Component type
   PXO_04660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127912..1128565
Genome map
AA seq 217 aa AA seqDB search
MRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSGWVTLL
DQRLKRDMATPPPLVNTSISGETTSGALTRLPGLLEKHHPGVVVIELGGNDALRGLTPTQ
LKGNLEKMIQLSQQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYKTALVPFFLEK
VVLQPGLMQADGLHPTAAAQPKVLETVWPALRPLLGS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctgctgacactctccctg
cttgcgccggggattgcctctgccaaacttccggtcgccaccgcgccgatcctggtcgtc
ggcgacagtctgagcgctgcgcacaacatcccggtccagtccggctgggtgaccttgctg
gaccagcgcctgaaacgtgacatggcgacgccacccccgctcgtcaataccagcatcagc
ggcgagaccacatccggtgcactgactcgcctgccgggcctgctggaaaaacaccatccc
ggcgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggcctgaccccgacccag
ctcaagggcaacctggaaaagatgatccagctcagccagcaggccggcgccaaggtgctg
ctgctggggatcgatgtgccgcccaattacggcccagcctaccgcgagcggctcaaggcg
acctacgccgacctctccaaacagtacaaaaccgcgctggtgccgttctttctggagaag
gtcgtgttgcagccgggcctgatgcaggccgacggtctgcaccccactgccgccgcccag
ccgaaggtactggagacggtgtggccagcgttgcgcccgctgctcgggtcctaa

DBGET integrated database retrieval system