KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04785Help
Entry
PXO_04785         CDS       T00763                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PXO_04785
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_04785
  Lipid metabolism
   00071 Fatty acid degradation
    PXO_04785
  Amino acid metabolism
   00350 Tyrosine metabolism
    PXO_04785
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PXO_04785
   00626 Naphthalene degradation
    PXO_04785
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PXO_04785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435501..1436532)
Genome map
AA seq 343 aa AA seqDB search
MHFERFEQVPEILQLPDPPPSDDGVVIKVAATGICRSDWHGWMGHDPDIALPHVPGHEFA
GEVVAMGKRISGFAIGTRVTVPFVSGCGRCVQCHGGNQQVCSNQFQPGFTAWGSFAEYVA
IDFAETNLVRLPESIDDATAASLGCRFATSFRAVVDQARTGPGEWVVVHGCGGVGLSAVM
IAAALGAQVIAVDIFDDKLAFAVECGAVATVNASKAANTVEAIREITKGGAHVSIDALGS
PTTCFNSISNLRRRGRHVQVGLMLGEHATPRIPMAQVIGHELEIYGSHGMQAWRYDAMLA
MIQAGKIAPQRLIGRRVCLDEAIAVLIGMDATRDLGISVIDRF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgagcgttttgaacaggtcccggaaattctgcagctccccgacccgccccca
agcgatgacggcgtggtgatcaaagtggcagccacaggcatctgccgcagcgattggcac
ggctggatggggcacgatccggacatcgcattgccgcacgtgccgggacacgagttcgcc
ggcgaagtggtcgccatgggaaaacgcatatcgggctttgcgatcggcacccgggtcacc
gtgccgttcgtgtccgggtgcgggcgctgtgtgcagtgccatggcggcaatcagcaagta
tgctcgaaccagttccagcccggcttcaccgcatggggatcgttcgccgagtatgtcgcg
atcgattttgccgagacaaatctggtcagactgccggagagcatcgacgatgcgacggcg
gcaagcctgggatgccggtttgccacctcgtttcgggcggtggtcgatcaggccagaacc
ggccctggcgaatgggtcgtggtccatggctgcggcggcgtcgggctttcggcagtgatg
atcgcagcggcactgggggcgcaggtgattgcggtggacatcttcgacgacaagctggcg
ttcgccgtcgaatgcggcgcggtcgcaacggtcaacgcgtcgaaagcggccaacacggtg
gaggcgattcgcgagatcaccaagggaggcgcgcacgtttccatcgatgcgctcggcagc
ccgacgacctgtttcaactccatcagcaacctgcgacggcgcggccgtcatgtccaggtg
ggactgatgctgggcgaacacgccacgcccaggatcccgatggcgcaggtgattggccac
gaactggagatctacggcagccacgggatgcaggcatggcggtacgatgccatgttggcg
atgatccaggccgggaagatcgcaccacaacggctcatcggcagaagggtgtgcctggac
gaggccattgcggtgctgattggcatggacgctacgcgcgacctcggcatcagcgtcatc
gatcgcttctag

DBGET integrated database retrieval system