KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04879Help
Entry
PXO_04879         CDS       T00763                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00020  Citrate cycle (TCA cycle)
xop00640  Propanoate metabolism
xop00660  C5-Branched dibasic acid metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
Module
xop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PXO_04879
   00640 Propanoate metabolism
    PXO_04879
   00660 C5-Branched dibasic acid metabolism
    PXO_04879
Enzymes [BR:xop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PXO_04879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: ACD58132
UniProt: B2ST87
Position
1500397..1501566
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPSGKVAATPDEAVDVATSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYKLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
tccggcaaggtcgcggcgacaccggacgaagcggttgacgtcgccacttccctgggcaag
ggtccttggatggtgaaagcgcagatccacgcgggtggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaacctggtgctggtgaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgcctcaagcgaaggcggcgtggagatcgagcaggtcgcggccgaaacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggttatcacggt
cgcgatttcggcttcaagctgggcctcaacgccaagcaggccggccagttcgccagcatc
atggtgaacttgtacaagctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggatggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctggtcgccatgcgcgacaagacgcaggaagacgag
accgaagtgaccgcctcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgccggcctggccatggcgaccatggacgtcatcaagctcaatggc
ggcgagccggcgaacttcctggacgtgggcggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgattgccgagggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system