KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04879Help
Entry
PXO_04879         CDS       T00763                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PXO_04879
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PXO_04879
   00640 Propanoate metabolism
    PXO_04879
   00660 C5-Branched dibasic acid metabolism
    PXO_04879
Enzymes [BR:xop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PXO_04879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1500397..1501566
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPSGKVAATPDEAVDVATSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYKLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
tccggcaaggtcgcggcgacaccggacgaagcggttgacgtcgccacttccctgggcaag
ggtccttggatggtgaaagcgcagatccacgcgggtggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaacctggtgctggtgaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgcctcaagcgaaggcggcgtggagatcgagcaggtcgcggccgaaacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggttatcacggt
cgcgatttcggcttcaagctgggcctcaacgccaagcaggccggccagttcgccagcatc
atggtgaacttgtacaagctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggatggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctggtcgccatgcgcgacaagacgcaggaagacgag
accgaagtgaccgcctcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgccggcctggccatggcgaccatggacgtcatcaagctcaatggc
ggcgagccggcgaacttcctggacgtgggcggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgattgccgagggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system