KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0053Help
Entry
XOC_0053          CDS       T01873                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xor00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53475..54605
Genome map
AA seq 376 aa AA seqDB search
MSAFCFSLRALLRYTLLFIVFGNLSLAHAQTRALTYAGVNLSGAEFASSQKPGVLNKDYT
YPASSDYTYFAGVGMNTIRLPILWERLQPTARGKLDPTQLALLQQAVARAKAAGMYLVID
LHNYAKYYGYKIGSPEVPVSTFTDVWRRLALTFKSDNAVMFGLMNEPNNISASEWAGAAQ
AAIDAIRKTGANNLILVPGALWTGAHSWYSPTSDGYSNATALASIYDPLNRYAFEVHQYL
DADSSGTSTTCVSATIGADRLRNFTKWLHTNRKRGFLAEFGTANNAVCNQALQGMLAHME
TNADVWLGWTWWSAGSWWNATYLYNVYPNKDGTDKPQMAILSPQAAKATRAPGATAARTS
ATATPKTSTSTARTTR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttctgtttttcgttgcgcgcgctactgcgctacacgctgcttttcatcgtg
tttggcaacctgtcgttggcccacgcgcagacgcgcgcgctcacctatgccggagtcaat
ctctcgggagccgagttcgcatcgtcccaaaaacccggggtcctcaacaaggactacacc
tatcccgcgtccagcgattacacctatttcgccggcgtcggcatgaacaccattcgcctg
ccgatcctgtgggaacgcctgcagcccaccgcgcgcggcaagctggatccaacccagcta
gcgttgctgcaacaggcggtggcacgcgccaaggcggccggcatgtatctggtgatcgat
ctccacaactacgccaagtattacggctacaagatcggcagcccggaagtaccggtgtcc
acgtttaccgatgtctggcgtcgcctcgcgctgacgttcaaaagcgacaatgcggtgatg
ttcgggctgatgaatgagcccaacaatatttcggccagcgaatgggccggcgcagcgcag
gccgccatcgatgcgatccgcaagaccggcgccaacaacctgattctggtgccgggcgca
ctgtggaccggcgcgcatagttggtactcccccacgtccgatggctactccaacgccacc
gcgttggcgtccatctacgacccgctcaatcgctacgctttcgaagtgcatcagtatctg
gacgccgattccagcggcaccagcaccacctgtgtcagcgccacgatcggcgccgatcgc
ttgcgtaacttcaccaaatggctgcatacaaaccgtaagcgcggtttcctggccgaattc
ggtaccgccaacaacgcggtctgcaaccaggcgctgcaaggcatgttggcgcatatggaa
accaacgcagatgtatggctgggttggacctggtggtcagccggttcgtggtggaacgcc
acctatttgtacaacgtgtatcccaacaaggacggcaccgacaaaccgcagatggcgatc
ctgtcgccacaggccgcaaaagccacgcgtgcgccgggcgctaccgctgcgcgtacttcc
gctacagctactcccaagacgagtacctccactgcacgcacgacacgctga

DBGET integrated database retrieval system