KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0225Help
Entry
XOC_0225          CDS       T01873                                 

Definition
transglycosylase, epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_0225
Enzymes [BR:xor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XOC_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209660..211822
Genome map
AA seq 720 aa AA seqDB search
MTLPRRALPLVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFG
QTQFMPSTYTRIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQTAGLLGTDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRGGPGLIATWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQTRLGLQPADGRPGQRILTALRAAPAVAGVAAVRATAFKLPAAY
PAFAQSPIVHKAFPMSDTTGLTTGDFHGFPSLLIETPFSTAAISLFGGQLVSFVPKGGQD
VMWLSPLAKQPPIPIRGGAPVCWPYFGRQAQTGDVPAHGFVRTVVWQLTESRREDDGTVV
LTLTPPRLDDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKVSAQ
GLDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRIVIA
TEGSRSLVAWNPGEEAGKKMADVGDGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccccggcgcgcattgccgttggtgctgggactgctgccactggccgcctgc
gccgatcccgccttcgaccgctgcctggctggcctgcagacccaggccgctgccaagggc
gtggaccctgcaggctttcagcgcttcaccgccgggctggtgcctgatcccagcgtgttg
ccgctgctggatgcgcagcccgaattcaccacgccgatctgggattacctggccagcctg
gtcgatagccagcgcgtgaccgatggccaggccatgctggtcacccaccgcgcgctgttg
actcgcctgtccgaacaaaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgactacggccgcgtcaccggcaagcgcccgctgctggtgtcgctggccacgctg
tcgtgtgcaggccgccgccagccgttcttccgtgacgaattcctcgccttgctcagcctg
ctgcaacgaggcgatctggctgcggatgggctgaccggctcctgggccggcgcattcggg
cagacccagttcatgccctcgacctacacccgcatcgcggtggatggcgacggcgacggc
cgccgcgatctggtcgccagcattcccgacgcactggcctccaccgccaactatctggtc
aaggccggctgggaacgcgcccgcccgtggggcatggaagtcacgctgccgcgcgggttc
gatgccagcaaggccggccgcacccgccgccaaccgctgcaggcctggcaaaccgccggc
ctgctcggcaccgacggcaaaccgctggcaccgatcgggttgccggcggagacccccgcc
gccttgctgctgccggccggcgccaccggccctgcgttcctggtgttccgcaactacgac
gccatttatgcttacaacgctgccgaaagttacgcgctgtccatcgccctgctcgccgac
cgcctgcgcggcggccccggcctgattgcgacctggcccaccgacgacccgggcctgggg
cggcccgaacggcgcgaactgcagcagttgctgcttgcccgcggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcaaccggccgacggccgtcccggccaacgcatcctcaccgccctgcgcgccgcg
ccagcggtcgccggcgttgcggccgttcgcgccaccgccttcaagctgccggccgcatac
ccggccttcgcccaatcccccatcgtgcataaggcattccccatgtccgacaccaccggc
ctgaccacaggcgatttccacggctttccatcgctgctgatcgaaacgccgttctccacc
gcggccatcagcctgttcggcgggcaactcgtgtcgttcgtgcccaagggcgggcaggac
gtgatgtggctgtcgccgctcgccaagcagccgcccatcccgatccgcggtggtgcgccg
gtgtgctggccgtatttcggtcgccaggcccagaccggcgatgtccccgcccacggcttc
gtccgcaccgtggtctggcaactcaccgaaagccgccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgcttggacgacctggcgttgcgcctgcgcatgacgctgcgc
atcggccgcacgctggagcaacgcctgatcaccgaaaacaccagcgccgccccggtgcgt
ttcacccaggcgctgcacaactatttccgcgtcggcgacgcgctgaaggtcagcgcgcag
ggcctggatggcctggactacctcgataaatacgagaactacgctaccgcacaccgtcag
caaggcgactggagcctgcgcgacccacgcgatcccggccgcagcgaccgcatctacacc
aatgccggtggccgctacacgctcaccgacccggtgctcggccgccgcatcgtcatcgcc
accgaaggcagccgctcgctggtggcctggaatccgggcgaagaggccggcaagaagatg
gccgacgtgggcgacggctggcgcgactacgtctgcctggaagcggccaacgccggcccg
gatgtgatcgaactcgcccccggcgccagccacaccctgacccagaccatcagtgtcgag
taa

DBGET integrated database retrieval system