KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0366Help
Entry
XOC_0366          CDS       T01873                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00010  Glycolysis / Gluconeogenesis
xor00620  Pyruvate metabolism
xor00640  Propanoate metabolism
xor00680  Methane metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
xor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_0366 (acsA)
   00620 Pyruvate metabolism
    XOC_0366 (acsA)
   00640 Propanoate metabolism
    XOC_0366 (acsA)
  Energy metabolism
   00680 Methane metabolism
    XOC_0366 (acsA)
Enzymes [BR:xor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XOC_0366 (acsA)
Lipid biosynthesis proteins [BR:xor01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XOC_0366 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: AEQ94603
UniProt: G7TLH6
Position
complement(367503..369446)
Genome map
AA seq 647 aa AA seqDB search
MADVYPVDPAFAADARVTREQYAALYRESIEHPEQFWGKAAQRLEWFKQPTQVKDVSYAL
DDFHIRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDAASYPVTYRQLYERVCKLG
NALRKLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSK
LIITADEGLRGGKKIPLKSNVDAALKVPGTHTIETVLVVRHTGGAVEMQAPRDRWFHDVV
DGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAI
RALMRDGVEPVKKTSRKSLRLLGSVGEPINPEAWRWYYDVVGDSRCPIVDTWWQTETGGI
LISPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDSWPGQMRSVYGDH
QRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVSHPR
VAEAAVVGFPHDVKGQGIYAYVTLIAGETPSDELHKELVSWVRKEIGPIASPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtttatcccgtcgatcccgcgttcgccgccgatgcgcgcgtgacgcgcgag
cagtacgccgcgctgtatcgcgaatcgatcgaacaccccgagcagttctggggcaaggcc
gcgcagcggttggaatggttcaagcaacccacccaggtcaaggacgtcagctacgcgctg
gacgacttccatatccgctggttcggcgatggcgagctcaacgccagcgtcaactgcctg
gaccgccagctggccacacgcggcgacaagaccgcgctgctgttcgaacccgacagcccg
gacgcggcgtcgtacccggtcacctatcgccagttgtatgagcgcgtctgcaagctcggc
aatgcgctgcgcaaactgggcgtcaagaagggcgaccgggtcaccatctatctgccgatg
atcgtcgatgcggcggtggccatgctcgcctgcgcgcgcatcggggcggtgcactcggtg
gtgttcggcggctttgccgccaactccatcgccgaccgcgtgatcgattgccagagcaag
ctgatcatcaccgccgacgaaggcctgcgcggcggcaagaagattccactcaagtccaac
gtcgatgcagcactgaaggttcccggcacccacacgatcgaaaccgtgctggtggtgcgt
cacaccggtggggccgtggagatgcaggcaccgcgcgatcgctggttccatgacgtggtc
gacggccaaccggcagaatgcgaacccgagcggatgaacgcagaagacccgctcttcatc
ctctatacctccggctccaccggcaaacccaagggcgtgctgcacaccactgccggctac
ctgctgtttgccagctacacgcacgaagtggtattcgacctgcgcgaggacgacatctac
tggtgcaccgccgacgtgggctgggtcaccggccatagctatatcgtctacggcccgctc
gccaacggcgccaccgcggtgatgttcgaaggcgtgcccaactacccgaacgtgtcgcgc
ttctgggaagtgatcgacaagcaccaggtcaccatcttctacaccgcgcctactgcgatt
cgcgcgttgatgcgcgacggtgtggaaccggtcaagaagacctcgcgcaagagcctgcgc
ctgctgggcagcgtcggcgagccgatcaatccggaagcctggcgctggtactacgatgtg
gttggcgacagccgctgcccgatcgtggacacctggtggcagaccgaaaccggcggcatc
ctgatctcgccgctggccggcgcggtcgatctcaagccaggctcggccaccctgccgttc
ttcggcgtgcagccagcgctggtggatgccgaaggcaagatcctggaaggtgccaccgaa
ggcaatctggtgctgctggattcctggccgggccagatgcgtagcgtctacggcgaccat
cagcgctttatcgatacctacttccgcacctatccgggcagctacttcaccggcgacggt
tgtcgccgcgatgccgacggctactactggatcaccggccgcgtggatgacgtgatcaac
gtgtcgggccaccgcatcggcaccgccgaagtggaaagcgcgctggtctcgcaccccagg
gtcgccgaagcggccgtggtcggctttccgcacgacgtcaagggccagggcatctatgcc
tacgtcaccctgatcgccggcgagactccgagcgacgaactgcacaaggaactggtgagc
tgggtgcgcaaggagatcggcccgatcgcctcgcccgatcacctgcagtgggctcccggc
ctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaaaac
gccccggaccagttgggcgacacctcgaccttagctgatccatcggtggtggattcgctg
gtcaatgagcggttgacgcgatga

DBGET integrated database retrieval system