KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0376Help
Entry
XOC_0376          CDS       T01873                                 

Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xor00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xor00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xor02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(378929..380557)
Genome map
AA seq 542 aa AA seqDB search
MPAIDPSAASPLPDSVATLAPPDPSRRRILIAGASLAAAGLLSPFARASGTADPFTLGVA
AGDPLADGFVIWTRLAPRPLDPDGRGGLRAAVPVRWQVASDPQMRTIVRQGQTVASPAWG
HAVHVELTGLAADRPYWYCFQALGARSPIGSARSLPAAHQMPDTARFGFVSCSHWELGYF
SAYRHLAAEQPDLVFFLGDYIYEYSNHGAAANKVVRPHGSGECLDLAGYRNRYALYRTDP
DLQALHAGSACVATWDDHEVQNDYANRWSQDPSIPVDTFLARRAAAYRAFYEHFPLRARH
RPHGADMRIYRSLDYGQLARFYVLDGRQYRSEQPCPQANGWRGGHVVADSCRERTDPRRT
MLGWEQERWLQRGFARSPARWNVIAQDLLVAPMRQSGRDGVVGHWTDGWDGYPATRERML
AAIAKTRLRNPVFWGGDIHSYWVTDLKADPADDASATLATEFVGTSITSDGQSNVELHAT
MAANPHVHYVDGETRGYVSVTVTPGQMETRLQGISDRRDRNATVSTTKRFVVQDGRPGAV
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgatcgacccgtctgccgcctcacccctgcccgattccgttgccacactggct
ccaccggatcctagccggcggcgcatcctcatcgctggcgccagtctggccgcggccggg
ctgctgagccccttcgcacgcgccagcggtactgccgacccgttcacgctgggggtggcg
gccggcgatccgttggccgatggctttgtgatctggacgcggctggcaccccgcccgctg
gacccggacggacgcggtggcctgcgcgcagcggtgccggtgcgttggcaggtggccagc
gacccgcagatgcgcaccatcgtgcgccagggccagaccgttgccagccccgcctggggc
catgcggtgcacgtggagctgaccggtctggcggccgatcgcccttactggtactgcttt
caggcactgggcgcacgcagcccgatcggcagcgcgcgtagcttgccggcagcgcatcag
atgccggacacggcgcggttcggctttgtctcctgctcgcactgggagctggggtatttc
agcgcgtaccgccacctcgccgcggagcagccggacctggtgttcttcctgggcgattac
atctacgagtacagcaaccacggcgcagcggcgaacaaagtcgtacgcccgcacggcagc
ggcgagtgcctggatctggccggctaccgcaaccgctacgccctctaccgcaccgacccg
gacctgcaagcgctgcatgccggcagtgcctgcgtggcgacctgggacgaccacgaggta
cagaacgattacgccaaccgctggtcgcaggacccgtcgattccggtcgacaccttcctg
gcacggcgcgctgccgcctatcgcgccttttacgaacatttcccgctgcgggcccggcat
cgcccgcatggtgccgacatgcgcatctaccgctcgctggattacggccagctggcgcgt
ttctacgtgctcgatggccgccagtaccgcagcgagcaaccctgcccgcaagccaatggc
tggcgcggcgggcatgtggtggccgacagttgccgcgagcgtaccgacccgcgtcgcacc
atgctcggttgggagcaggagcgctggctgcagcgcggcttcgcacggtcgccggcgcgc
tggaatgtcattgcgcaggatctgctggtggcaccgatgcgccaatccggtcgcgatggc
gtcgtcggccactggaccgacggctgggacggctacccggccacgcgcgagcgcatgctc
gctgcgattgcgaagacgcgcttgcgcaaccccgtgttctggggcggcgacattcactcg
tattgggtcaccgacctgaaggccgatccggccgacgacgcgtcggcaacgctggccacc
gagttcgtcggcacctcgatcacctccgacggccagagcaatgtcgaactgcacgcgacg
atggcagccaacccgcacgtgcactacgtggacggcgaaacgcgcggctatgtgtcggtg
acggtcacgccgggccagatggaaacgcggctgcaaggcatctccgatcggcgcgaccgc
aacgcgacagtgtcgacgacgaaacgcttcgtggtgcaagacggcaggcccggtgcagtg
gaggcctga

DBGET integrated database retrieval system