KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0671Help
Entry
XOC_0671          CDS       T01873                                 

Definition
major extracellular endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOC_0671
Enzymes [BR:xor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XOC_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669510..670610)
Genome map
AA seq 366 aa AA seqDB search
MPSSIDYSRNADLQGLTSLQVLDKVINAFNARGMYVLLDHHTPDCAGISELWYTGAYSQA
QWLDDLRFVANRYKNVPSVIGVELKNEPHGTATWGTGNADTDWNKAAELGSAAVLAVAPK
WIIAVEGITDNPVCSTNGGIFRGGSLQPLACTPLNIPANRLLLAPHAYGPDVYVQSYFND
SNFPNNMPAIWDRHFGQFAGNHALLLGEFGDKYGDGDARDKVWQNALVKYLRSKGINQGF
YWTWNPNSSDTGGILRDDWTTVREDKMTLLRTLWGTTPTPTPSASFSTKVIQDSTWNGGY
CNRVQDTNTGTASGTWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDFNRTLAAGATAEF
GDCAAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcatcgactacagccgcaacgccgacttgcagggcctgacgtcgctgcag
gtcctcgacaaggtgatcaacgcattcaacgcgcgcggcatgtatgtgctgctggatcac
cacactcccgattgcgccggcatttccgagctgtggtacaccggcgcgtattcccaagcg
caatggctggacgatctgcgctttgtcgccaatcgctacaagaacgtaccgagcgtgatc
ggcgtggagctgaagaacgagccgcacggcaccgctacctggggcaccggcaatgctgac
accgactggaacaaggccgccgagcttggctcggccgccgtcctggcggtagcgccgaag
tggatcattgcggtggaaggcatcaccgacaacccggtgtgttcgaccaatggcggcatc
ttccggggcggcagcctgcagccgctggcctgcaccccattgaacattccggccaaccgc
ctgttgctggcaccgcatgcgtacggcccggacgtgtacgtgcagtcgtacttcaacgac
agcaacttccccaacaacatgcccgccatttgggaccgtcacttcggtcagttcgccggt
aatcatgcgctgctgctcggcgaattcggcgacaagtacggcgacggcgatgcgcgtgac
aaggtgtggcagaacgcgctggtgaagtacctgcgtagcaagggcatcaaccaagggttc
tactggacgtggaaccccaacagcagcgacaccggtggcatcctgcgcgacgactggacc
acggtgcgcgaagacaagatgaccttgctgcggacgctatggggcaccaccccgacgccg
acgccgagcgctagcttcagcaccaaggtgatccaggacagcacgtggaacggtggctac
tgcaaccgcgtgcaagacaccaataccggcaccgccagcggcacgtggtcgatctcgctg
acggtcaccggcacggtcaacaatgcctggaatgtcacctggtcgcagagcggcaccacg
ctgcaggccagcggcgttgacttcaaccgcaccctggctgccggtgcaacggccgagttc
ggcgactgcgcggcaagctga

DBGET integrated database retrieval system