KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0900Help
Entry
XOC_0900          CDS       T01873                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xor01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909656..910309
Genome map
AA seq 217 aa AA seqDB search
MRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSGWVTLL
DQRLKRDMATPAPVVNASISGETTSGALTRLPGLLEKHHPAVVVIELGGNDALRGLTPTQ
LKGNLEKMIQLSQQAGAKVLLLGIDMPPNYGPAYRERLKATYADLAKQYKTALVPFFLEK
VVLQPGLMQADGLHPTAAAQPTVLETVWPALRPLLGS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctgctgacactctccctg
cttgcgccggggattgcctctgccaaacttccggtcgccaccgcgccgatcctggtcgtc
ggcgacagtctgagcgctgcgcacaacatcccggtccagtccggctgggtgaccttgctg
gaccagcgcctgaaacgtgacatggcgacgccagcgccggtcgtcaatgccagcatcagc
ggcgagaccacatccggagcactgactcgcctgccgggcctgctggaaaaacaccatccc
gccgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggcctgaccccgacccag
ctcaagggcaacctggaaaagatgatccagctcagccagcaggccggcgccaaggtgctg
ctgctggggatcgatatgccgcccaattacggcccagcctaccgcgagcggctcaaggcg
acctacgccgacctcgccaaacagtacaaaaccgcgctggtgccgttctttctggagaag
gtcgtgttgcagcccggcctgatgcaggccgacggtctgcacccgacggccgccgcccag
ccgacggtactggagacggtgtggccagcgttgcgcccgctgctggggtcctga

DBGET integrated database retrieval system