KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0900Help
Entry
XOC_0900          CDS       T01873                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XOC_0900
Enzymes [BR:xor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XOC_0900
   3.1.2  Thioester hydrolases
    3.1.2.-  
     XOC_0900
Lipid biosynthesis proteins [BR:xor01004]
 Fatty acid synthase
  Component type
   XOC_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909656..910309
Genome map
AA seq 217 aa AA seqDB search
MRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSGWVTLL
DQRLKRDMATPAPVVNASISGETTSGALTRLPGLLEKHHPAVVVIELGGNDALRGLTPTQ
LKGNLEKMIQLSQQAGAKVLLLGIDMPPNYGPAYRERLKATYADLAKQYKTALVPFFLEK
VVLQPGLMQADGLHPTAAAQPTVLETVWPALRPLLGS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctgctgacactctccctg
cttgcgccggggattgcctctgccaaacttccggtcgccaccgcgccgatcctggtcgtc
ggcgacagtctgagcgctgcgcacaacatcccggtccagtccggctgggtgaccttgctg
gaccagcgcctgaaacgtgacatggcgacgccagcgccggtcgtcaatgccagcatcagc
ggcgagaccacatccggagcactgactcgcctgccgggcctgctggaaaaacaccatccc
gccgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggcctgaccccgacccag
ctcaagggcaacctggaaaagatgatccagctcagccagcaggccggcgccaaggtgctg
ctgctggggatcgatatgccgcccaattacggcccagcctaccgcgagcggctcaaggcg
acctacgccgacctcgccaaacagtacaaaaccgcgctggtgccgttctttctggagaag
gtcgtgttgcagcccggcctgatgcaggccgacggtctgcacccgacggccgccgcccag
ccgacggtactggagacggtgtggccagcgttgcgcccgctgctggggtcctga

DBGET integrated database retrieval system