KEGG   Xanthomonas oryzae pv. oryzicola: XOC_0911Help
Entry
XOC_0911          CDS       T01873                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XOC_0911 (folA)
   00670 One carbon pool by folate
    XOC_0911 (folA)
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     XOC_0911 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918917..919411
Genome map
AA seq 164 aa AA seqDB search
MKVILIVAFDRNNAIGRDNDLPWKLPDDLKRFKALTLGKPILMGRKTAQSLGRALPGRLN
LVLTRSGLVPFDGMQAVASVAQAVERAVQDGAQELCVIGGGEVYRLTMERADVLAVTEVD
TAVDDADTHFPLIDPAAWSPVRRQLHPADDRHAYAFSFVDYERR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcttgatcgtcgccttcgaccgcaacaacgccatcggccgtgataacgat
ctgccgtggaaactgcccgatgatctcaagcgcttcaaagcgctgacgctgggcaagccg
atcctgatggggcgcaagacggcgcagtctctcgggcgtgccttgccggggcggttgaat
ctggtgctgacgcgttcggggctggtgccgttcgacggcatgcaggcggtggcatcggtg
gcgcaggcggtcgaacgcgccgtgcaagacggtgcgcaggagctgtgcgtgatcggtggc
ggggaggtatatcgcctgaccatggaacgtgccgatgtgctagccgtgaccgaagtggac
acggcggtagacgatgccgacacgcattttccgctgatcgacccggcggcgtggtcgcct
gtgaggcgtcagttacatcctgccgacgatcggcacgcctatgcgttttcgttcgtggat
tacgaacgccgctga

DBGET integrated database retrieval system