KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_1161Help
Entry
XOC_1161          CDS       T01873                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XOC_1161 (recR)
DNA repair and recombination proteins [BR:xor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     XOC_1161 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XOC_1161 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 TniQ
Motif
Other DBs
NCBI-ProteinID: AEQ95350
UniProt: G7TFZ4
Position
1133357..1133950
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLATTLANAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFVLQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcactgctagaacaactgatcgaggccttccgggtattgcccggtgtgggccag
aagtcggcgcagcgcatggcgtatcacgtgctcgagcgcgagcgcgagggtgggcggcgt
ctggcgacgacgttggccaatgcggtggaaaaggtggggcattgcgtgcagtgccgcgac
ttcaccgagtccgagatctgcaccatttgcgccagcagcagtcgcgaccggcagcaattg
tgcgtggtcgaatcgccggccgaccgcctggcgatcgagcatgccaccggctaccgcggg
ctgtatttcgtcctgcaggggcgcctgtcgccgctggatggcatcggcccacgcgaactg
ggattggatcggctcggcgagcgtctggccgctggcgaagtgaccgaaatgatcatcgcc
accaacgccaccgtggaaggcgaggcgaccgcccattacctcgcgcagcttgcccgccag
cacgcggtacgcccgagccggcttgcccagggcatgccgctgggcggcgagctggaatac
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctgtga

DBGET integrated database retrieval system