KEGG   Xanthomonas oryzae pv. oryzicola: XOC_1447Help
Entry
XOC_1447          CDS       T01873                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xor00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:xor00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431537..1432811
Genome map
AA seq 424 aa AA seqDB search
MAKIVVTGGQALQGEVNISGAKNAVLPILCATLLADAPVEISNVPHLHDVITTVKLLSEL
GAEVTIDEGTLAKGRSILVDPRSVTHQIAPYELVKTMRASILVLGPLLARYGTAEVSLPG
GCAIGSRPVDQHIKGLQALGAEISVENGYIKATSRGRLKGGRYVFDMVSVTGTENVLMAA
VLAEGTTVLENAAMEPEVTDLADCLIALGAQIEGAGTPRIVVQGVERLGGGHHAVLPDRI
ETGTFLVAAAMTGGSVTVRRARPETLDAVLDKLTEAGATITTTADSITLDMQGKRPRAVS
LTTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGHTAI
VRGAARLSGAPVMATDLRASASLILAGLVADGDTTIDRIYHLDRGYENIEEKLGALGATI
QRTA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgtagtgaccggcggccaagcgctgcagggcgaagtcaatatttccggt
gccaagaacgcagtgctgccgatcctgtgcgcgaccctgctcgccgacgcgccggtggag
atcagcaacgtgccgcatctgcacgacgtgatcaccacggtgaaattgctcagcgagctg
ggtgccgaagtcaccatcgacgaaggcacgctggccaagggccgttcgatcctggtcgac
ccacgctcggtcacgcatcagatcgcgccgtacgagctggtcaagaccatgcgcgcctcg
atcctggtgctgggcccgctgctggcgcgctacggcaccgccgaagtgtcgctgcccggc
ggctgcgcgatcggctcgcgcccggtggatcagcacatcaagggcctgcaggcgctgggt
gccgagatcagcgtggagaacggctacatcaaggccaccagccgcgggcgcctgaagggc
ggccgctacgtgttcgacatggtcagcgtcaccggcaccgagaacgtgctgatggccgcg
gtgctggccgagggcaccacggtgctggaaaacgcggcgatggagccggaagtcaccgac
ctggccgactgcctgatcgcacttggcgcgcagatcgaaggtgccggaaccccgcgcatc
gtggtgcagggcgttgagcggctgggcggcgggcaccatgcggtgctgccggaccgcatc
gaaaccggcaccttcctggtcgctgcggcgatgaccggcggcagcgtcaccgtgcgccgc
gcccgcccggaaaccctggatgcagtgctggacaagctcaccgaagccggcgccaccatc
accaccaccgccgacagcatcacgctggacatgcagggcaagcgcccgcgcgcagtcagc
ctgaccaccgcgccgtacccggcgtttcccaccgatatgcaggcgcaattcatggcgctc
aactgcgtggcagacggcgtgggcgtgatcaacgaaaccatcttcgaaaaccgcttcatg
cacgtcaacgagctgctgcgcctgggcgcggacatccaggtcgaaggccacactgccatc
gtgcgtggtgccgcacgcctgagcggcgcgccggtgatggccaccgacctgcgcgcatcg
gcgtcgctgatcctggctggcctggtggccgatggcgacactaccatcgaccgcatctac
cacctggaccgtggttacgaaaacatcgaggagaagctgggggcgctgggcgcgaccatc
cagcgcaccgcatga

DBGET integrated database retrieval system