KEGG   Xanthomonas oryzae pv. oryzicola: XOC_1554Help
Entry
XOC_1554          CDS       T01873                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_1554
   01230 Biosynthesis of amino acids
    XOC_1554
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_1554
  Energy metabolism
   00680 Methane metabolism
    XOC_1554
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOC_1554
Enzymes [BR:xor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XOC_1554
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XOC_1554
  Exosomal proteins of melanoma cells
   XOC_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1526674..1527423
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLK
RAIHTLQGALKELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVDDPGHPCHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDVSNEQILELNIPTGIPLLFELDDNLQVRSFRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaatctggacaaccgt
ttcaccggctgggtggatgtggaactcaccgaccagggccgccaggaagctgtggcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtcgcccacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgttgaaggaactcgaccaggactggttgccggtg
tccaagagctggcgcctcaacgagcgccactacggcggcctgcaaggcctggacaaggcc
gaaaccgcggccaagcacggcgaggagcaggtcaagatctggcgccgttcgtacgacatc
ccgccgccggcgatggacgtcgacgacccggggcacccgtgtcacgaccgtcgctacgcc
acgctcgatcgcaatgcgttgccgggcaccgagtcgctggcgaccacgttggtgcgcgtg
ttgccgtattggcacgacgcgattgcgccgcagttgaaggccgggcagaccgtgctggtg
accgcgcacggcaactcgctgcgtgcgctgtacaagtacctcaacgatgtctccaacgaa
cagattctggagctcaatatccccaccggcatcccgctgttgttcgagctggacgacaat
ctgcaggtgcgcagcttccgttatctgggcgatccggaagcggccaagcgtgcggccgag
gcagtggccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system