KEGG   Xanthomonas oryzae pv. oryzicola: XOC_1752Help
Entry
XOC_1752          CDS       T01873                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_1752 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XOC_1752 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XOC_1752 (sucB)
Enzymes [BR:xor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XOC_1752 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1732319..1733521)
Genome map
AA seq 400 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPADEKKAAAPAAAAPAAAPAAAAAPAPASTSAADS
LPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVPMTRVR
KTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFADVEQGIADYAAK
ARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHTIKERPIAENGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggcgaagcggtcaagcgcgacgagaatctggtcgacctggaa
accgacaaggtcgtgttggaagttccgtcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagattctggcgatcatcgaagaaggcgct
gtggctgcggctgcaccggcggacgagaagaaggccgccgcaccggcagcagcagctcca
gctgccgcgccggctgccgccgctgcaccggcgcctgcgtccacgtctgctgccgattcc
ctgccgccgggtgcgcgtttctctgcgatcacccagggtgtggatccgtcgcaggtcgag
ggcacaggccgtcgtggcgcggtgaccaaggaagacatcgtcaacttcgccaaggccggc
ggcgtgggcaaggcctcgggtgcccgcccggaagagcgcgtgccgatgacccgcgtgcgc
aagacgattgccaagcgcctgatggagtccaagaactccaccgcgatgctgaccaccttc
aacgaggtcaacctggccaaggtatcggccgcacgcaaggaactgcaggacgaattccag
aaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggccgccgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctatcacggc
tacagcgacatctcgatcgcggtgtcgaccgacaagggcctggtcacgccggtgctgcgt
aacgtcgagcgccagtcgttcgccgatgtcgaacagggcatcgccgattacgccgccaag
gcacgcgccggcaagctgggcctggatgacctgcagggcggcaccttcaccatcaccaat
ggcggcaccttcggctcgctgctgtccaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacacgatcaaggaacgcccgatcgccgagaatggccaggtcgtgatcgcc
ccgatgatgtatctggcgctgtcttacgaccaccgcatcatcgatggtaaggattcggtg
cagttcctggtcgacatcaagaaccagctggaaaacccgggccgcatgctgttcggtctg
taa

DBGET integrated database retrieval system