KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2161Help
Entry
XOC_2161          CDS       T01873                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xor00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xor00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2156129..2157466
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRESDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNSALARAEAKSDAAFEFFTKLGVPYYCFHDIDLSPDADDI
GEYERNLKHMVGVAKQRQADTGIKLLWGTANLFSHPRYMHGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARLLTLARDYGRSIGFTGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTSSPLEQWRAERYASFDNGAGADFAAGKITLTDLATHA
AGNAPKQISGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtctacatcggcgcgaaagaatatttccccggcatcggcaagatcggt
ttcgaaggccgcgagtcggacaacccgctcgcgttcaaggtctacgatgccaacaagacc
attggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggtacgcgtgcgtatccgtgggatgtgggc
aacagcgcgctggcgcgggctgaagccaaatccgatgccgcgttcgagtttttcaccaag
ctcggcgtgccgtattactgcttccacgacatcgacctgtcgccggatgccgatgacatc
ggcgaatacgagcgcaacctcaagcacatggtgggtgttgccaagcagcgtcaggccgac
accggcatcaagctgctgtggggcacggccaatctgttctcgcatccgcgctacatgcat
ggtgcctcgaccaacccggacttcaacgtcgtcgcgcgtgcggcggtgcaggtcaaggcc
gcgatcgatgccacggtggagctgggcggcgaaaactacgtgttctggggcggccgtgaa
ggctatgcctgcctgcacaacacccagatgaagcgcgagcaggacaacatggcgcgcttg
ctcaccctggcgcgcgactacggccgcagcatcggcttcaccggcaacttcctgatcgag
cccaaacccatggagccgatgaagcatcagtacgattttgatagcgcgaccgtgatcggt
ttcctgcgtcagcacggcctggatcaggacttcaagctcaacatcgaagccaaccacgcc
accttgtccggccatagcttcgagcatgacctgcaggtcgcctccgatgccggcctgctg
ggcagcatcgatgccaaccgcggcaacccgcagaacggttgggataccgaccagttcccg
accgacctgtacgacaccgttggtgcgatgctggtggtgctgcgtcagggtggcttggca
ccgggggggttgaatttcgacgccaaggtgcgtcgcgaatcgtccgacccgcaggacctg
ttcctggcgcacatcggcggcatggacgcgttcgcacgcgggctggaagtggccaacgca
ctgctgacgtcctcgccgttggagcagtggcgcgccgaacgttatgccagcttcgacaat
ggtgccggcgccgactttgccgcaggcaagatcacactgacggatctggccacgcatgcc
gccggcaatgcgcccaagcagatcagcggccgccaggaagcgtacgaaaacttgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system