KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2168Help
Entry
XOC_2168          CDS       T01873                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xor00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2163755..2164240
Genome map
AA seq 161 aa AA seqDB search
MQTAFVGLGANLGPAEASVRAAIATLGAVPQTTLIAASRLYRTPAWGRADQPDFINAVAQ
LRTGLAPLPLLEALLGIEQAFGRERRAGERWGPRTLDLDLLLYAEQVIDLPQLQVPHPHL
HARAFALLPLSELAPQAIIPGHGTVRHALQAIDTCGLEPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgcctttgtcggcctgggtgccaacctgggcccggccgaggccagcgtgcgc
gcggccattgccacgctgggcgcggtgccgcagaccacgctgatcgcagcgtcgcgtctg
taccgtacgccggcctggggccgcgcagaccagccggatttcatcaatgccgtggcgcag
ctgcgcaccggcctcgcgccgctgccgctgctggaagccttgctcggcatcgaacaggcg
tttggccgcgagcgtcgcgccggcgagcgctggggcccgcgcacgctggatctggacctg
ctgttgtacgccgaacaggtgatcgatctgccgcagttgcaggtgccgcatccgcatctg
cacgcgcgtgccttcgcactgctgccgctgtccgaactggcgccgcaggcgatcattccg
ggccatggaacagtgcggcacgccctgcaagccatcgatacctgcgggctggagccgatt
gggtag

DBGET integrated database retrieval system