KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_2216Help
Entry
XOC_2216          CDS       T01873                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00340  Histidine metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01230  Biosynthesis of amino acids
Module
xor_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XOC_2216 (hisD)
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XOC_2216 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEQ96353
UniProt: G7TE28
Position
2209916..2211211
Genome map
AA seq 431 aa AA seqDB search
MKILDWSQLDVAARTDALTRPVQTVAAQTRDAVAALIADVRTRGDAALREITARLDGVSL
ERLAVSEAEFAAAEAAVAPELRQAMQDAVARIDTFHRAGMSEGYAVETAPGVVCEKIVRS
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCRAVVLCTPPRKDGSVDPAVLVAARLTGVR
RVFKLGGAQAIAAMAYGTESVPSCDKLFGPGNSYVTEAKQQVAQSCAAAIDMPAGPSEVL
VIADAGAQAAFVAADLLSQAEHGADSQVLLLSDSDVLIDAVQAQLEIQLAHLSRADIARQ
ALAQSRLIKVQTLDEAFAISNRYAPEHLILALREPRAWLVQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIAGIGECALILARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctcgattggtcacaactcgatgtcgccgcacggaccgatgcgttgactcgc
ccggtgcagaccgtggccgcacagacgcgcgatgcggtcgccgcgttgattgccgacgta
cgcacgcgcggcgatgcggcattgcgcgagatcaccgcgcgcttggatggcgtgtcgctg
gagcgcttggcagtgagcgaagccgaattcgccgccgccgaagcggccgttgcgccggaa
ctgcgccaggccatgcaggatgccgtggcacgcatcgacaccttccaccgcgctggcatg
agcgaaggttatgcggtggaaaccgcgccgggtgtggtgtgcgaaaagatcgtgcggtcg
atcggccgtgtgggcctgtacgtaccggccggcagcgcgccgttgccgtcgacggccttg
atgttgggcgttccggcgcgtctggccggttgccgcgcggtggtgttgtgtacgccgccg
cgcaaggacggcagcgtggatccggcagtgctggtcgcggcgcggctcaccggcgtgcgc
cgtgtgttcaagctcggcggtgcgcaggcgattgcggcgatggcgtatggcaccgagtcg
gtgcccagctgcgacaagttgttcggcccgggcaacagctatgtcaccgaagccaagcag
caggtggcgcagtcctgtgcggcggcgatcgacatgccggccggcccgtccgaagtcttg
gtgatcgccgatgccggcgcgcaagcggcgttcgtggctgccgacctgctatcgcaggcc
gaacacggcgcggattcgcaggtgttgttgctgtccgacagcgacgtgttgatcgatgcg
gtgcaggcgcagctggagatacagttggcgcacctctcacgtgccgacatcgcgcgtcag
gcgctggcgcaatcgcgcttgatcaaggtgcagacgctggatgaggcgtttgcgatcagc
aaccgctatgcgccggagcatctgattcttgcgctgcgcgaaccgcgcgcgtggctggtg
caagtcgaggcagccggctcggtatttctcggcgattacacacccgaagcactcggcgat
tattgcagtggcaccaaccacgtgttgccgaccagcggtgcggcgcgcgcgtacagcggc
gtcagcgtggccagtttccagaacatggtcagcgtgcaggcggccagcaaggccggcatc
gctggcatcggcgaatgcgcgttgatactcgcgcgcgcagaaggcttggacgcgcatgcc
aatgcagtggcactgcgcatgggagtggcagcatga

DBGET integrated database retrieval system