KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2520Help
Entry
XOC_2520          CDS       T01873                                 

Definition
cytochromeC peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2557153..2558145
Genome map
AA seq 330 aa AA seqDB search
MTQPPAPARPDHRTQRWTPVAIMKVAFASTAFLAMPSMPATGVAAPSVRPHEPIHAIQPA
TGLDSRKVALGALLFDDRRLSGDNRLACTSCHRLSSNGAAADATTRTPGRVPPAFNTPTI
FNATANFRLGWRGNFRSLEVQTASVLEKPSVMQADIATIVGRLRQDTVLNQRFRAAYGRP
PDRAALLDAIASYERSLVTPGSRFDLWLQGSDTALNAQELRGYRTFKSIGCISCHQGVNV
GGNLFQRSGIFAPVTRDGTPILRVPSLRNVATTAPYFHDGSASTLPQAIKVMGTTQLGVA
LSPADVSDIAAFLNTLTGKHQGRQLTAPHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgccggcgccggctcggccagaccatcgcacacagcgctggacgccggtg
gcgatcatgaaggtcgcgttcgcttccacagcgttcctcgcgatgccgtccatgccggcg
actggcgttgcagccccgtcggtgcgccctcatgagcccatccatgccatccaaccagca
accggcctggacagccgcaaggttgcgctgggcgcactgctgttcgatgatcgccggctg
tcgggcgataaccgccttgcctgcacgtcttgtcatcgcctgtccagcaacggtgccgct
gccgatgcaacgacccggacgcccgggcgggtgccgccagcgttcaatacaccgaccatt
ttcaatgcgacagcgaactttcgcctgggctggcgcggcaacttccgcagtctggaagtg
caaacggcttcagtgctcgaaaagccaagcgtcatgcaggccgatatcgcgacgatcgtc
ggacgactgcgacaagacacggtgctcaatcagcgctttcgcgcggcctatggcaggcca
ccggatcgcgccgcgctgctcgatgccattgccagctacgaacgctcgctggtcacgccg
ggcagtcgcttcgacctctggctgcaaggcagcgacacggcattgaacgcacaagagtta
cgcggctatcgcaccttcaagtcgatcggctgcatttcctgccaccaaggcgtcaacgtg
ggcggcaatctgttccagcgcagcggcatcttcgctcccgtcacacgagatggcaccccg
atcctgcgggttcccagcctgcgtaacgttgccacgaccgccccgtacttccacgacggc
agcgccagcaccctgccccaggcgatcaaggtgatgggcaccactcaacttggcgtcgca
ctgagccctgcggatgtctccgatatcgctgcgtttctgaacacattgaccggcaagcac
cagggtcggcagctgacggcgccccacccatga

DBGET integrated database retrieval system