KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2608Help
Entry
XOC_2608          CDS       T01873                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOC_2608 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_2608 (glk)
   00052 Galactose metabolism
    XOC_2608 (glk)
   00500 Starch and sucrose metabolism
    XOC_2608 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_2608 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOC_2608 (glk)
   00524 Butirosin and neomycin biosynthesis
    XOC_2608 (glk)
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XOC_2608 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2677590..2678597
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADVDASVPLLDDTSREFAVVDFASLGEAARYYLDQIGV
QATQGVFAVAGRVDGDEARITNHPWVISRSRTASMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIDQPRNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRALSEIAGVDPGPLQPKDITARAAAGDPRS
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSRVPSLAVMHPHAGLLGAAAYAVDAQRQPPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgatatcggcggaaccaatgcgcgcttc
gcgctggccgatgtcgacgcctcggtgccgttgctggatgacacctcgcgcgaatttgcc
gtggtggacttcgcctcgctcggcgaagccgcgcgctattacctcgaccagatcggcgtg
caggccacccagggcgtgttcgccgtggccggccgcgtggatggcgacgaagcacgtatc
accaatcacccgtgggtgatctcgcgttcgcgcactgccagcatgctgggtttcagtacc
ttgcacctgatcaacgacttcgccgcgcaggcgatggcgatcagcctgctgcgtccgcag
gacgtggtgcaggtgggcggcgccagctggcgcccggcgccgatcgatcagccgcgcaac
tacggcgtgatcggccccggcaccggcctgggcgtgggtggcctgatcatccgcaacggg
cgctgctttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gaaatccgcatcctggaaatcctctccgagcagttcggccgggtttccaacgagcgcctg
atctgcggcccgggcctggtcaacatccaccgcgcgctgagtgagattgccggagtcgat
ccgggcccgctgcaacccaaggacatcaccgcacgcgccgcggcgggcgacccgcgttcg
tcgcgcacgatcgatctgttctgcgccatcttcggagcgatcgccggcgacatggtgctc
atgcagggtgcctgggacggcgtgttccttaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggctttcgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgcgggtgccgtcgctggcggtcatgcacccgcatgcgggcctgctcggcgccgcc
gcgtatgcggtggatgcacaacgtcagccccccggggaacagcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system