KEGG   Xanthomonas oryzae pv. oryzicola: XOC_2687Help
Entry
XOC_2687          CDS       T01873                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XOC_2687
   00052 Galactose metabolism
    XOC_2687
   00500 Starch and sucrose metabolism
    XOC_2687
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_2687
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XOC_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2758428..2759321)
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPQEKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAEL
LKKEQVDAFRFQGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggcagtattccccgtcgcaggtcttggaacccgctttctt
ccggcaaccaagacggtgccgaaagaaatgctgccaatcatcgacaagcccttgatccag
tacgccgtcgacgaagccatccaggctggttgcgatacgttgatctttgtgaccaaccgc
tacaaacactccattgccgactacttcgacaaggcctacgagctggagcaaaagcttgag
cgtgcaggcaagttggagcagctcgagctagtacgccatgcgttgccggaaggcgttcgc
gccatttttgtgacgcaggcagaagcgctcggcctgggccacgcggtgttgtgtgccaag
gccgtggtcggtgacgaaccgttcgcggtgctgctgccggacgatctgatgtggaaccgc
ggcgatgccgcgctgacccagatggccgatgttgcagaggcctccggcggcagcgtcatt
gcggtggaagatgtgccgcaggaaaagacggccagctacggcatcgtctctaccgatgca
ttcgatggccgcaagggccgcatcaatgcgatcgtcgagaagcccaagccggaagtggcg
ccgagtaatctggccgtagtcggtcggtatgtgctgagcccgaagatcttcgaatttctc
gaggctaccggtgcaggcgcgggcggcgagatccagctgaccgacgcgattgccgagctg
ctgaagaaagagcaggtcgatgccttccgtttccaaggtcgccgtttcgattgcggtgcg
catatcggcctgatcgaagccaccgtgcatttcgcgctcgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaacgcattggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system