KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_2780Help
Entry
XOC_2780          CDS       T01873                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00790  Folate biosynthesis
xor01100  Metabolic pathways
Module
xor_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XOC_2780 (folP)
Enzymes [BR:xor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XOC_2780 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEQ96887
UniProt: G7TJ68
Position
complement(2849241..2850143)
Genome map
AA seq 300 aa AA seqDB search
MFDTALTLDCAGRSLRLDTPQVMGIVNVTPDSFSDGGQHASCEAAIAHGLALVEQGAAVL
DIGGESTRPGATPVSVEEELQRVIPVIEALAQRTRVPISVDTFKPEVMRAAVAAGAGMIN
DVYALRSPDALEAASDLRVPVVLMHARSAPHAMQDAPQYDDVVGEVHRFLAERIFAAEMA
GIDKRRLILDPGFGFDKTTTHNLAVLAQLQRLQEFGLPVLAGLSRKRSIGELTGREVAAE
RVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWNAMAAIPVPRVSAPAAPTIRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataccgccctcacactggattgcgccggccgcagcctgcggctggatacgccg
caggtgatgggtatcgtcaatgtcacgcccgattcgttctccgacggcggccagcatgcc
agctgcgaagcggcgattgcgcatggactggcgctggtggagcagggtgctgcggtgttg
gatatcggcggtgagtccacacgcccgggtgccacgccggtatcggttgaagaagaactg
cagcgggtgattccggtcatcgaagcactggcgcaacgcacccgcgttccgatcagcgtg
gatacgttcaaaccggaggtcatgcgtgcagcggtcgcggccggcgcgggcatgatcaac
gacgtgtatgcactgcgttcgcccgatgcactggaggcggcgtcggacctgcgcgtgccg
gtggtcctgatgcatgcgcgcagcgcgccgcacgccatgcaagatgcgccgcagtacgac
gatgtggtgggggaagtccaccgctttctggccgagcgcatcttcgccgccgagatggcc
ggcatcgacaagcgccgactgatcctggaccctggtttcggcttcgacaagaccaccacg
cacaacctcgctgtgcttgcgcagctgcagcgcctgcaggaatttggcttgccggtattg
gccgggctgtcccgcaaacgcagcatcggcgaattgaccgggcgtgaggttgccgccgaa
cgtgtgcacggctcggtggccgcgcatctgatcgccgcccagcacggcgcgctgctgttg
cgcgtgcacgatgtggcggccaccgtggatgcgttgaaggtatggaacgcgatggcggcg
attccggtcccgcgtgtcagcgcgccggccgcaccgacgatccgttggccggacgaggac
tga

DBGET integrated database retrieval system